BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1072 (717 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S39392-1|AAB22439.2| 703|Homo sapiens protein tyrosine phosphat... 30 9.5 M64572-1|AAA35647.1| 913|Homo sapiens protein-tyrosine phosphat... 30 9.5 DQ104439-1|AAZ20185.1| 839|Homo sapiens tyrosine phosphatase pr... 30 9.5 BC126117-1|AAI26118.1| 913|Homo sapiens protein tyrosine phosph... 30 9.5 AL450025-1|CAH73252.1| 913|Homo sapiens protein tyrosine phosph... 30 9.5 AL359963-4|CAH71094.1| 913|Homo sapiens protein tyrosine phosph... 30 9.5 AL162733-1|CAH73386.1| 913|Homo sapiens protein tyrosine phosph... 30 9.5 >S39392-1|AAB22439.2| 703|Homo sapiens protein tyrosine phosphatase protein. Length = 703 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 80 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 119 >M64572-1|AAA35647.1| 913|Homo sapiens protein-tyrosine phosphatase protein. Length = 913 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 >DQ104439-1|AAZ20185.1| 839|Homo sapiens tyrosine phosphatase protein. Length = 839 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 >BC126117-1|AAI26118.1| 913|Homo sapiens protein tyrosine phosphatase, non-receptor type 3 protein. Length = 913 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 >AL450025-1|CAH73252.1| 913|Homo sapiens protein tyrosine phosphatase, non-receptor type 3 protein. Length = 913 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 >AL359963-4|CAH71094.1| 913|Homo sapiens protein tyrosine phosphatase, non-receptor type 3 protein. Length = 913 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 >AL162733-1|CAH73386.1| 913|Homo sapiens protein tyrosine phosphatase, non-receptor type 3 protein. Length = 913 Score = 29.9 bits (64), Expect = 9.5 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 62 RFKRARSRDYDLKNSVSND*SCKTLWKEFIQNY*AYSVSK 181 R K+A SR++ + ++ N SCK LWK ++++ + K Sbjct: 273 RQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKK 312 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,971,701 Number of Sequences: 237096 Number of extensions: 1325781 Number of successful extensions: 1882 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8399192100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -