BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1066 (628 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1599 - 38539460-38539480,38539973-38540054,38540185-385402... 29 2.3 09_06_0134 + 21065104-21065965,21066732-21066961,21067618-210678... 29 4.0 04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420... 28 7.0 09_02_0389 - 8456957-8459917,8461941-8462267 27 9.2 03_06_0011 - 30995083-30995108,30995850-30996038,30996063-30998856 27 9.2 >01_06_1599 - 38539460-38539480,38539973-38540054,38540185-38540255, 38540359-38540489,38550539-38550614,38551229-38551588 Length = 246 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 489 PVKLVEVIQLSSRLKGKPFSSYLGPRN 569 PV+L++++ L S ++GK +GP N Sbjct: 158 PVELLQILPLKSTIRGKDIGPQIGPNN 184 >09_06_0134 + 21065104-21065965,21066732-21066961,21067618-21067841, 21067929-21068781 Length = 722 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 261 RIDEYKQLEGESIVCTLRQHQPRRHSVRGVEHVSRNLSLVQEL 389 +I YK+ E + I L +H+P + + + +EH+S ++ L Sbjct: 598 KISAYKRAENKVIETKLLEHRPEQDAKQRMEHLSEKKEMLNVL 640 >04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052, 33742154-33742560,33743342-33743476,33743576-33743970, 33744225-33744916,33745014-33745097,33745195-33745286, 33745374-33745457,33745535-33745714,33746258-33746302, 33746399-33746692,33747199-33747585,33747713-33747899, 33748042-33748118,33748936-33749067,33749315-33749416, 33749744-33749827,33749902-33749992,33750105-33750178, 33750644-33750664,33751433-33751477,33752427-33752561, 33752693-33752752 Length = 1376 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 292 NPSYVPLGSISLEGIVSEELNMSVGIFPW 378 N +V + +SLE I E+LN+ + F W Sbjct: 42 NGDFVAIKQVSLENIPQEDLNIIMSTFMW 70 >09_02_0389 - 8456957-8459917,8461941-8462267 Length = 1095 Score = 27.5 bits (58), Expect = 9.2 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 511 MTSTSLTGSCKRLTLASLR*RVHLLTLHSSKKTLYRWPKSTSSWTKERFLL 359 + S LTG+C R SL HL L+ S + P+S S + +FL+ Sbjct: 554 LRSLDLTGTCIRYIPKSLEHLHHLRLLNLSLTQVLELPESIESLSNLQFLI 604 >03_06_0011 - 30995083-30995108,30995850-30996038,30996063-30998856 Length = 1002 Score = 27.5 bits (58), Expect = 9.2 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 277 NSWKGNPSYVPLGSISLEGIVSEELNMSVGIFPWSKSL*ISAIGKESSLKNA 432 NS +GNPS P G +L V + +++ G P S S + + G S ++ A Sbjct: 658 NSIQGNPSLQPCGLSTLANTVMKARSLAEGDVPPSDSATVDSGGGFSKIEIA 709 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,443,348 Number of Sequences: 37544 Number of extensions: 311256 Number of successful extensions: 822 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -