BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1064 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50421| Best HMM Match : CUB (HMM E-Value=0) 46 2e-05 SB_44568| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1138| Best HMM Match : CUB (HMM E-Value=0) 44 7e-05 SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51551| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32181| Best HMM Match : CUB (HMM E-Value=0) 42 3e-04 SB_9360| Best HMM Match : CUB (HMM E-Value=2.5e-35) 42 5e-04 SB_43366| Best HMM Match : CUB (HMM E-Value=3.6e-39) 42 5e-04 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_963| Best HMM Match : CUB (HMM E-Value=1.8e-19) 40 0.001 SB_50707| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1140| Best HMM Match : CUB (HMM E-Value=0) 40 0.002 SB_18721| Best HMM Match : CUB (HMM E-Value=0) 40 0.002 SB_5269| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37619| Best HMM Match : CUB (HMM E-Value=1.9e-37) 39 0.003 SB_51552| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_23022| Best HMM Match : CUB (HMM E-Value=0) 38 0.005 SB_35182| Best HMM Match : CUB (HMM E-Value=0) 38 0.005 SB_22138| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) 37 0.011 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 37 0.015 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 37 0.015 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_17635| Best HMM Match : CUB (HMM E-Value=0) 36 0.019 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 36 0.019 SB_46260| Best HMM Match : CUB (HMM E-Value=7.3e-24) 36 0.026 SB_42999| Best HMM Match : CUB (HMM E-Value=1.12104e-44) 36 0.034 SB_46951| Best HMM Match : CUB (HMM E-Value=1.3e-32) 35 0.045 SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) 35 0.045 SB_55637| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_48224| Best HMM Match : CUB (HMM E-Value=0.06) 35 0.059 SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 35 0.059 SB_5309| Best HMM Match : CUB (HMM E-Value=2e-35) 35 0.059 SB_6611| Best HMM Match : CUB (HMM E-Value=1.2e-06) 34 0.10 SB_51549| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_2719| Best HMM Match : CUB (HMM E-Value=1.9e-24) 34 0.10 SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_10092| Best HMM Match : CUB (HMM E-Value=5.5e-34) 33 0.14 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 33 0.18 SB_192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23) 32 0.32 SB_35680| Best HMM Match : Sushi (HMM E-Value=4.4e-22) 32 0.32 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 32 0.32 SB_25209| Best HMM Match : Astacin (HMM E-Value=7.69999e-41) 32 0.42 SB_32180| Best HMM Match : DUF1459 (HMM E-Value=4.8) 31 0.55 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 31 0.55 SB_9652| Best HMM Match : CUB (HMM E-Value=0.0017) 31 0.55 SB_49085| Best HMM Match : CUB (HMM E-Value=0.019) 31 0.55 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 31 0.55 SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_27587| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 30 1.7 SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) 30 1.7 SB_4874| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_34490| Best HMM Match : CUB (HMM E-Value=1.3e-07) 29 2.2 SB_1486| Best HMM Match : CUB (HMM E-Value=4e-10) 29 2.2 SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_38048| Best HMM Match : CUB (HMM E-Value=1.4e-31) 29 2.9 SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) 29 2.9 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) 29 3.9 SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30) 29 3.9 SB_8648| Best HMM Match : C2 (HMM E-Value=0.98) 29 3.9 SB_6197| Best HMM Match : C2 (HMM E-Value=3.7e-24) 29 3.9 SB_59715| Best HMM Match : Fz (HMM E-Value=0.026) 28 5.1 SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12) 28 6.8 SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_23321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_19179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_23834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_50421| Best HMM Match : CUB (HMM E-Value=0) Length = 270 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = -3 Query: 525 PSVI*LTNYKMKVVFRTDSDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLL 346 P I T ++ + F++D + GFKA ++ CGG + + SP YP YP+ Sbjct: 124 PPSIWSTGSRLWIKFKSDGVESRPGFKAVYETRCGGPI--RKAHGTIQSPKYPSWYPSSK 181 Query: 345 NCTYEISAPDKKTEI--KFVEFELE 277 C + I+ P K + + +FV F++E Sbjct: 182 ECVWTIAFPGKGSRVGMRFVAFDVE 206 Score = 36.3 bits (80), Expect = 0.019 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Frame = -2 Query: 202 YCGKQKPPMM--IGDKINLELKSDEFLTQKGFKIAFKTFDCGGHINST--TMIKSTRTEK 35 +CG + PP + G ++ ++ KSD ++ GFK ++T CGG I T+ Sbjct: 118 FCGTRVPPSIWSTGSRLWIKFKSDGVESRPGFKAVYET-RCGGPIRKAHGTIQSPKYPSW 176 Query: 34 YHENMNCTWII 2 Y + C W I Sbjct: 177 YPSSKECVWTI 187 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELE 277 SP YP YP +C + IS P ++ + F F L+ Sbjct: 55 SPGYPSPYPLGRHCEWRISVTPGERIVLNFTVFHLK 90 >SB_44568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 45.6 bits (103), Expect = 3e-05 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 11/97 (11%) Frame = -3 Query: 525 PSVI*LTNYKMKVVFRTDSDINLDGFKARWD----------PICGGNFIATEKEQFLYSP 376 P+ + T + M + F+TD + GF W P CGG+ T L SP Sbjct: 628 PATVRSTGHYMWIKFKTDDRTSHKGFDISWTSLQDPTSKRIPRCGGH--VTRSTGSLTSP 685 Query: 375 NYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSY 268 +P YP ++CT+ I+ K+ ++ F F++E S+ Sbjct: 686 GFPTAYPGAVDCTWVITGDRGKRLQVWFDHFDIENSH 722 Score = 33.5 bits (73), Expect = 0.14 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = -3 Query: 435 DPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELEGSYPDC 259 D C G ++A + +F SP++P YP+ +CT+ I A K ++F F++EG P C Sbjct: 546 DHSCSGTYVA-DGGRFT-SPDFPLNYPDNSDCTWLIKVAEGKIISLRFNYFDVEG--PIC 601 Query: 258 S 256 + Sbjct: 602 T 602 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 199 CGKQKP-PMM-IGDKINLELKSDEFLTQKGFKIAFKTFDCGG 80 CG+ P P +GD I L L S+ + GF+I +++ D GG Sbjct: 746 CGRTAPGPFKSLGDSIRLTLHSNGQTERSGFRIRWRSVDLGG 787 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 605 CTKDAVIIYDWKDNEYQEIAKLCGRNVP 522 CT D + I+D +Y + K CG +P Sbjct: 601 CTYDWIAIHDGPSVKYPLLGKFCGSTIP 628 >SB_1138| Best HMM Match : CUB (HMM E-Value=0) Length = 499 Score = 44.4 bits (100), Expect = 7e-05 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = -3 Query: 444 ARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELEGSY 268 A +DP N + + + SPNYP +YPN ++CT+ IS D + ++ F +F ++ + Sbjct: 357 ASYDPSVNNNLQVSGQTGTIKSPNYPAQYPNSISCTWVISVKDGNRVKLSFSDFWIDDQH 416 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 387 LYSPNYPDEYPNLLNCTYEISAPDKKT 307 L++PNYP EYP+ CT + D K+ Sbjct: 265 LFTPNYPQEYPSNKECTDAVELRDGKS 291 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISA 322 SPNYP YP+ +CT+ I A Sbjct: 43 SPNYPKVYPSYSSCTWIIGA 62 >SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 42.7 bits (96), Expect = 2e-04 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 1/84 (1%) Frame = -3 Query: 525 PSVI*LTNYKMKVVFRTDSDINLDG-FKARWDPICGGNFIATEKEQFLYSPNYPDEYPNL 349 P +I T+ + + F++D ++ F+ + ICG +F T SP +P+ Y Sbjct: 108 PKIIYSTSNTLWLRFQSDFRTEIENKFRLTYTAICGRHF--TSSSGSFASPGFPNLYAPN 165 Query: 348 LNCTYEISAPDKKTEIKFVEFELE 277 + C Y I AP + +I+F F+LE Sbjct: 166 IECVYTIFAPLGRIKIEFGTFDLE 189 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 202 YCGKQKPPMM---IGDKINLELKSDEFLTQKGFKIAFKTFDCG 83 YCG Q PP + +G I L KSD KGF F+T G Sbjct: 229 YCGNQLPPTVYSTLGSHIWLRFKSDSSGESKGFSARFRTVSVG 271 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = -3 Query: 483 FRTDSDINLDGFKARWDPICGGNFIA----TEKEQFLYSPNYPDEYPNLLNCTYEI 328 F++DS GF AR+ + G + K L+S NYP +P C++EI Sbjct: 250 FKSDSSGESKGFSARFRTVSVGEGSCEGKLSGKRGHLFSQNYPFLFPRNKECSWEI 305 >SB_51551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 42.7 bits (96), Expect = 2e-04 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = -3 Query: 498 KMKVVFRTDSDINLDGFKARW----DPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYE 331 ++++ F +D + GFKA + P CG + I + + SP YP YP C + Sbjct: 12 RLRLKFVSDREGRHRGFKAEYATSLTPGCGWD-IEDSPKTAITSPYYPSFYPAATECIWR 70 Query: 330 ISA-PDKKTEIKFVEF-ELEGSYPDC 259 + A P++ I+FVEF + GS P C Sbjct: 71 VRAPPNQYVSIRFVEFVGVNGSTPAC 96 >SB_32181| Best HMM Match : CUB (HMM E-Value=0) Length = 588 Score = 42.3 bits (95), Expect = 3e-04 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 6/73 (8%) Frame = -2 Query: 202 YCGKQKPPMMIG--DKINLELKSDEFLTQKGFKIAFKT--FDCGGHINST--TMIKSTRT 41 YCG QK ++ D++ LE +S L G +I + + F+CGG++NS+ ++ Sbjct: 119 YCGYQKGELIYSKTDEVRLEYESTSGLANAGLQIHYTSLLFECGGYLNSSRGSIQSPLYP 178 Query: 40 EKYHENMNCTWII 2 + Y N+ C W I Sbjct: 179 DNYPNNVYCAWQI 191 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEI-SAPDKKTEIKFVEFELE 277 CGG ++ + SP YPD YPN + C ++I P ++ F+ +LE Sbjct: 161 CGGYLNSSRGS--IQSPLYPDNYPNNVYCAWQIEQRPGYAVDLLFLTLDLE 209 Score = 34.3 bits (75), Expect = 0.078 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = -3 Query: 495 MKVVFRTDSDINLDGFKARWDPI---CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS 325 M V F T+ + GF + C NF T + SPNYPD YP +C++ IS Sbjct: 252 MLVEFVTNGRVARSGFDISYTQYRGDCPRNF--TNASGIVESPNYPDFYPKGYDCSWLIS 309 Query: 324 AP-DKKTEIKFVEFELEGS 271 + + F FEL+ S Sbjct: 310 YELGYQIYVTFTYFELDYS 328 Score = 27.9 bits (59), Expect = 6.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 608 NCTKDAVIIYDWKDNEYQEIAKLC 537 NC++D + ++D DN Q + + C Sbjct: 213 NCSRDYIEVFDGPDNSSQSLGRFC 236 >SB_9360| Best HMM Match : CUB (HMM E-Value=2.5e-35) Length = 275 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 414 FIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELE 277 F T ++ SPNYP +YPN + C + ++ P + I FV+F+ E Sbjct: 25 FAGTHTSGYITSPNYPSDYPNNVQCVWVLNLQPGTEARITFVDFKTE 71 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 390 FLYSPNYPDEYPNLLNCTYEI 328 ++ SP YP+ YPN ++C + I Sbjct: 186 YIQSPRYPNSYPNNMDCRWTI 206 >SB_43366| Best HMM Match : CUB (HMM E-Value=3.6e-39) Length = 306 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -3 Query: 435 DPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELE 277 + +CGG I + + SPNYP YP+ + C ++I +P K ++ F FELE Sbjct: 189 EDLCGG--ILYGPKGIIQSPNYPSSYPSRVGCLWQILSPKGKHVKLTFETFELE 240 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -3 Query: 411 IATEKEQFLYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSYPDCS 256 I T ++SPNYP YP ++CT+ IS P + F+ F+LE P C+ Sbjct: 1515 IMTTPSGEIFSPNYPGYYPGSMSCTWRISVPVGNVIRLTFIMFDLEDD-PLCA 1566 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -3 Query: 498 KMKVVFRTDSDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNL 349 ++K+VF + + GF+ R+D + G K F YS N+ ++P+L Sbjct: 1601 RLKIVFTSTAFSGRQGFRLRYDAVVG------NKALFFYS-NFQKKFPSL 1643 >SB_963| Best HMM Match : CUB (HMM E-Value=1.8e-19) Length = 507 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 405 TEKEQFLYSPNYPDEYPNLLNCTYEISA-PDKKTEIKFVEFELEGSYPDC 259 T + SPNYP YP+L +C + I+ P + E+ F +F+LE S C Sbjct: 5 TATSGIIVSPNYPSLYPDLSDCRWTITVPPGHQIELDFQDFQLEWSPLSC 54 >SB_50707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = -3 Query: 432 PICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIKFVEFELEGSY 268 P CGG + T + + SPN+P+ YP +C + + P + +++F F E SY Sbjct: 438 PPCGG--VVTTLDSTIQSPNFPNYYPLNADCVWVVK-PGRAFQLEFASFHTEDSY 489 >SB_1140| Best HMM Match : CUB (HMM E-Value=0) Length = 410 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 7/79 (8%) Frame = -3 Query: 495 MKVVFRTDSDINLDGFKARW-----DPICGGNFIATEKEQFLYSPNYPDEYP-NLLNCTY 334 MK+ F ++S GF A D IC + E + + SP +P+ YP ++ C + Sbjct: 93 MKMRFLSNSAEEFTGFNATITSLTEDEICPQKAVLNETKGTIQSPLFPNNYPAEIMRCAW 152 Query: 333 EISAPD-KKTEIKFVEFEL 280 EI+AP+ K ++ F F++ Sbjct: 153 EITAPEGKHVKLTFKHFDV 171 >SB_18721| Best HMM Match : CUB (HMM E-Value=0) Length = 288 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/80 (28%), Positives = 36/80 (45%) Frame = -3 Query: 525 PSVI*LTNYKMKVVFRTDSDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLL 346 P + + +++V R++S + GF + G N T + SP YPD YP + Sbjct: 138 PESLVTSGNEVEVRMRSNSTQSGRGFLITYSEFEGCNKTLTSSSGVIESPYYPDSYPLNV 197 Query: 345 NCTYEISAPDKKTEIKFVEF 286 NCTY I + +EF Sbjct: 198 NCTYRIQVTAGQLVSLAIEF 217 Score = 36.3 bits (80), Expect = 0.019 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELE 277 CGGN + + L PNYP + PN+ CT+ I+ AP + + F LE Sbjct: 57 CGGNLSNSTGQ--LTHPNYPRDMPNIGTCTWRITLAPGSRVALHFSFLNLE 105 >SB_5269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = -3 Query: 483 FRTDSDINLDGFKARWDPI-CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKK 310 F +D +N GF+ + C +F T + SPN+PD +P ++C+Y+I A Sbjct: 319 FHSDFSVNERGFRLLFTRSGCSHSF--TGSSGVIASPNHPDRHPISVDCSYKIEVASGHI 376 Query: 309 TEIKFVEFELEG 274 + F F+LEG Sbjct: 377 VALSFERFDLEG 388 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/51 (27%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELE 277 CGG + E + SP +P++YP+ ++C ++++ D + +KF +F+++ Sbjct: 185 CGGMITGSAGE--ITSPYFPEKYPDEVDCFWKLTGEDGSRVTLKFTQFQVK 233 >SB_37619| Best HMM Match : CUB (HMM E-Value=1.9e-37) Length = 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = -3 Query: 447 KARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP--DKKTEIKFVEFELEG 274 KA CGG + ++ ++SP YP +YP C + + AP ++K + F FE+E Sbjct: 9 KAYLSEACGGR--QSGQQGVVFSPGYPGQYPTRTRCVWVLVAPSANQKIRLSFDAFEIEP 66 Query: 273 S 271 S Sbjct: 67 S 67 >SB_51552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 420 GNFIATEKEQFLYSPNYPDEYPNLLNCTYEISA-PDKKTEIKFVEFELE 277 G+ I ++ L SP YP EY CT+ +SA P+ K I+F EF L+ Sbjct: 34 GDIIYVSEDGTLESPRYPSEYGTDHMCTWVLSAKPEAKITIEFEEFSLQ 82 >SB_23022| Best HMM Match : CUB (HMM E-Value=0) Length = 1307 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELEGS 271 CGG + + + SP+YP YP C + I+ P ++ +KF +F LEG+ Sbjct: 3 CGG--VLSNGNGTITSPSYPASYPKNKRCLWRITGPSGQRISLKFNDFRLEGN 53 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELE 277 CG T + SPN+P Y + +CT++I+ P E+ F ++E Sbjct: 175 CGST--VTSLTGLIMSPNFPGVYQHKKDCTWKITVTPGSHVELNFRFLQIE 223 >SB_35182| Best HMM Match : CUB (HMM E-Value=0) Length = 963 Score = 38.3 bits (85), Expect = 0.005 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Frame = -2 Query: 202 YCGKQKPPMMI---GDKINLELKSDEFLTQKGFKIAFKT----FDCGGHINST--TMIKS 50 +CG + P I G+ + ++L SD+ T KGF+ ++T CGG ++ TM Sbjct: 170 FCGTKPPKAAIRSSGNSMYVKLTSDDGDTGKGFRATWRTASRDIKCGGVFSNLTGTMTSP 229 Query: 49 TRTEKYHENMNCTWII 2 Y N++C WII Sbjct: 230 MFPSNYPANVDCEWII 245 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELEGS 271 CGG T L SPN+P YP + C + I P + E+ ++E S Sbjct: 96 CGGR--VTGSRGTLTSPNFPSPYPTDVTCEWVIRVGPKQAIELTIETIDIEQS 146 >SB_22138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/50 (32%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = -3 Query: 411 IATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIK--FVEFELEGSY 268 I ++ + + SPNYP YP +CT+ I+ PDK ++ F +F+++ ++ Sbjct: 69 IESQTDGDILSPNYPRPYPPETDCTWIITLPDKAKQVAVIFKDFDVQEAH 118 >SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) Length = 405 Score = 37.1 bits (82), Expect = 0.011 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = -3 Query: 525 PSVI*LTNYKMKVVFRTDSDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLL 346 P + ++ K+ + FR++S GF A + P C N T + SPN+P+EY + Sbjct: 326 PRPVMSSSNKLWIRFRSNSSQPSVGFYAVYFPSC--NAYLTNNSGVIKSPNHPNEYYHNS 383 Query: 345 NCTYEIS-APDKKTEIKFVEFE 283 CT+ ++ A K + F F+ Sbjct: 384 RCTWLVTVAQGKAIRLNFQAFK 405 Score = 33.1 bits (72), Expect = 0.18 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 6/73 (8%) Frame = -2 Query: 202 YCGK----QKPPMMIGDKINLELKSDEFLTQKGFKIAFKTFDCGGHI-NSTTMIKS-TRT 41 YCG+ +P M +K+ + +S+ GF + C ++ N++ +IKS Sbjct: 318 YCGEFEVTPRPVMSSSNKLWIRFRSNSSQPSVGFYAVYFP-SCNAYLTNNSGVIKSPNHP 376 Query: 40 EKYHENMNCTWII 2 +Y+ N CTW++ Sbjct: 377 NEYYHNSRCTWLV 389 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 36.7 bits (81), Expect = 0.015 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 429 ICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKT-EIKFVEFELE 277 +CGG + L SPNYP+ Y +C Y+I AP T + FV+F LE Sbjct: 70 VCGGTYEGLHGS--LTSPNYPNNYYINSDCVYKIVAPVGYTIKATFVDFALE 119 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 405 TEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELEGSYPDC 259 T +L++P YP YP+ C++ I+ P + + F+ FELE +P C Sbjct: 672 TSHSGYLHTPFYPAYYPDYARCSWLITVPKAHRIRLSFLSFELE-EHPIC 720 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 387 LYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSYPDC 259 L SP+YP +YP C++ I+ P ++ E++F F+LE P C Sbjct: 387 LTSPDYPAQYPLNKECSWSITVPRGQRVELRFQFFDLEAD-PSC 429 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELE 277 CGG F + + + SP YP +YP C + I+A + + +KF F+LE Sbjct: 191 CGGAF--SGQGGTITSPGYPSKYPKNKKCVWTITAQEGGRIHLKFDTFQLE 239 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -3 Query: 378 PNYPDEYPNLLNCTYEISAP--DKKTEIKFVEFELEGS 271 P YP +YP C + + AP ++K + F FE+E S Sbjct: 71 PGYPGQYPTRTRCVWVLVAPSANQKIRLSFDAFEIEPS 108 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELE 277 CGG F + + + SP YP +YPN C + I+A + + +KF F+LE Sbjct: 2 CGGAF--SGQGGTITSPGYPSKYPNNKKCVWTITAQEGGRIHLKFDTFQLE 50 >SB_17635| Best HMM Match : CUB (HMM E-Value=0) Length = 630 Score = 36.3 bits (80), Expect = 0.019 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%) Frame = -3 Query: 495 MKVVFRTDSDINLDGFKARWDPICG----GNFIATEKEQFLYSPNYPDEYPNLLNCTYEI 328 ++VVF +D +L GF + + G+F+ K + + SPNYP+ YP C + I Sbjct: 148 IRVVFHSDP-ASLQGFPGSFLAVFRKQPCGDFLTGIKGE-IRSPNYPNPYPAGKECIWRI 205 Query: 327 SAPDKK-TEIKFVEFELE 277 PD ++ F+ F LE Sbjct: 206 QVPDNMVVKLYFLVFALE 223 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = -3 Query: 432 PICGGNFIATEKEQF--LYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFEL 280 P+ GG T ++ + SP +P+ YPN C++ I P +K + F+ F++ Sbjct: 47 PLGGGECTYTIQDASGEITSPGFPEPYPNSAQCSWTIIMPHYEKILLTFLTFKV 100 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 36.3 bits (80), Expect = 0.019 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = -3 Query: 453 GFKARWDPICGG--NFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFE 283 G+ A PI G N T + SPNYP YP NC + I+AP D I F F Sbjct: 1568 GYCATTPPIAGSACNEHFTAPYGNITSPNYPGYYPRDTNCEWRITAPVDHVIRITFRSFH 1627 Query: 282 L 280 L Sbjct: 1628 L 1628 >SB_46260| Best HMM Match : CUB (HMM E-Value=7.3e-24) Length = 830 Score = 35.9 bits (79), Expect = 0.026 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 2/77 (2%) Frame = -3 Query: 483 FRTDSDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP--DKK 310 FR+D+D N GF+A + + G T + +P+YP YP C +EI+ P K Sbjct: 181 FRSDADGNGRGFRATYKAL-GSTPRYTGD---IKTPHYPASYPPREICDWEITGPPGTTK 236 Query: 309 TEIKFVEFELEGSYPDC 259 +I+F +F ++ + C Sbjct: 237 LDIQFEDFAIDDAPVTC 253 >SB_42999| Best HMM Match : CUB (HMM E-Value=1.12104e-44) Length = 362 Score = 35.5 bits (78), Expect = 0.034 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -3 Query: 453 GFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELE 277 GF A+ IC AT F+ SP++P YP+ L+C + I+ + KF FELE Sbjct: 198 GFFAQKTGICNVELNATSG--FITSPSHPQNYPHSLSCLWLINLGMGYRITTKFHSFELE 255 Query: 276 GSYPDC 259 DC Sbjct: 256 -EEKDC 260 >SB_46951| Best HMM Match : CUB (HMM E-Value=1.3e-32) Length = 194 Score = 35.1 bits (77), Expect = 0.045 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP--DKKTEIKFVEFELEGSYPDC 259 CGG T SPN+P YP+ C + I+AP + +I F F++E P C Sbjct: 28 CGGTI--TGASGTFSSPNFPSNYPDNAMCEWTITAPVGTSRIDIAFPAFDVEWG-PSC 82 >SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) Length = 644 Score = 35.1 bits (77), Expect = 0.045 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 4/68 (5%) Frame = -3 Query: 471 SDINLD---GFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISA-PDKKTE 304 SDI +D G K+ + +CGG T+ L SP YP++YP L+C +++ A D++ Sbjct: 531 SDIYVDLSQGLKSDQE-VCGGTI--TKDYGILRSPGYPNKYPAGLDCQWKVFARKDRRIR 587 Query: 303 IKFVEFEL 280 F F++ Sbjct: 588 FWFGIFDI 595 >SB_55637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 34.7 bits (76), Expect = 0.059 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 429 ICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEI-SAPDKKTEIKFVEFELEGSYPD 262 IC + I+ +E + SP YP +Y N NCT I P K E F++ +E Y D Sbjct: 31 ICDIDSISGVREGEVTSPGYPLDYGNYRNCTMVIDGGPYTKIEFTFLDMAVE-EYED 86 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP 319 CGG + T +E + SPN+P YP+ +C + IS P Sbjct: 294 CGG--VLTAREGLIMSPNHPRPYPSDTHCKWVISLP 327 >SB_48224| Best HMM Match : CUB (HMM E-Value=0.06) Length = 60 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP 319 CGG + T +E + SPN+P YP+ +C + IS P Sbjct: 5 CGG--VLTAREGLIMSPNHPRPYPSDTHCKWVISLP 38 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 34.7 bits (76), Expect = 0.059 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKFVEFELEG 274 C +F T + SPN+PD +P ++C+Y+I A + F F+LEG Sbjct: 2 CSHSF--TGSSGVIASPNHPDRHPISVDCSYKIEVASGHIVALSFERFDLEG 51 >SB_5309| Best HMM Match : CUB (HMM E-Value=2e-35) Length = 300 Score = 34.7 bits (76), Expect = 0.059 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 387 LYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELEGSYPDCS 256 L SPNYPD Y + T++I+AP ++ F F LE S +CS Sbjct: 135 LSSPNYPDHYGGNTDFTWKITAPQGHHVKLTFTAFRLEPS-DNCS 178 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS 325 CG F + + S N+P+ YP NCT+ I+ Sbjct: 4 CGEVFSDDALQGTISSKNWPNPYPQGTNCTWTIT 37 >SB_6611| Best HMM Match : CUB (HMM E-Value=1.2e-06) Length = 100 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSY 268 SPN+P +YP+ CT+ I+ P + ++ F F++E Y Sbjct: 16 SPNFPRDYPHNAECTWTITVPRGRYVKLMFGTFDVETFY 54 >SB_51549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 630 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSY 268 SPN+P +YP+ CT+ I+ P + ++ F F++E Y Sbjct: 546 SPNFPRDYPHNAECTWTITVPRGRYVKLMFGTFDVETFY 584 >SB_2719| Best HMM Match : CUB (HMM E-Value=1.9e-24) Length = 614 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSYPDC 259 SPNYP YP+ +CT+ I AP D ++F S P C Sbjct: 25 SPNYPGTYPDNSSCTWVIKAPRDHTVTLRFGSMFNIMSVPTC 66 >SB_52865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 33.5 bits (73), Expect = 0.14 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = -3 Query: 465 INLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISA--PDKKTEIKFV 292 I L GF R ICGG + TE + + P YP C + I A P+ + F+ Sbjct: 19 IILVGFVCRSRAICGGRTVLTELNGTI--SDGPSNYPENTQCEWLIKAPRPNMTITLNFL 76 Query: 291 EFELEGSY 268 E+ E +Y Sbjct: 77 EYGTECTY 84 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEIKF 295 CGG + E L SPN+P YPN C + IS +P K ++ F Sbjct: 1272 CGGELKSDTGE--LSSPNFPANYPNNKECIHSISVSPGKVIKLDF 1314 Score = 30.7 bits (66), Expect = 0.97 Identities = 19/71 (26%), Positives = 30/71 (42%) Frame = -3 Query: 471 SDINLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIKFV 292 S + L+ A W + I T + SPNYP+ YP C I ++ F Sbjct: 1420 SALQLNDLVAIWYFLDQCGAILTAPIGLITSPNYPESYPGNELCNMTIKVDKGPIKVAFQ 1479 Query: 291 EFELEGSYPDC 259 F++ G+ +C Sbjct: 1480 SFDI-GTENNC 1489 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -2 Query: 253 DNLTVSYAETYDYFSE-VYCGKQKPPMMIGDKINLELK--SDEFLTQKGFKIAFKTFD 89 D + V E ++ SE ++CG+ +P I N+ +K SDE + +GFK +F + Sbjct: 1334 DFVKVMDGECGNFRSETLFCGQDQPAPFISTGNNMCVKFFSDESQSGQGFKASFSAIN 1391 >SB_10092| Best HMM Match : CUB (HMM E-Value=5.5e-34) Length = 119 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSYPDCS 256 SPNYP YP C + I+AP D I F F+L P C+ Sbjct: 15 SPNYPGYYPRDTKCEWRITAPVDHVIRITFRTFQLP-ELPRCA 56 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAP 319 CG I T F+ SPNYP +YP+ +C + I P Sbjct: 719 CGA--IYTVPAGFIVSPNYPQDYPSNSHCRWAIMLP 752 >SB_192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 32.3 bits (70), Expect = 0.32 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELEGSYPDCS 256 SPNYP YP C + I+AP D I F F+L P C+ Sbjct: 296 SPNYPGYYPRDTKCEWLITAPVDHVIRITFRTFQLP-ELPRCA 337 >SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23) Length = 898 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -3 Query: 417 NFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPD-KKTEIKFVEFELEGSYPD 262 N+ T++ SP +P YPN C++ I + + ++F F L S D Sbjct: 221 NYTLTDRHGSFQSPYFPSNYPNGQLCSWRIMGIEGESIRVRFSNFSLSNSTDD 273 >SB_35680| Best HMM Match : Sushi (HMM E-Value=4.4e-22) Length = 442 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 387 LYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELE 277 + S N+P+ Y N CT+EI P KK + F E E Sbjct: 273 IQSTNFPNNYENNEYCTWEIRVPTGKKVRLDFTELRTE 310 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 387 LYSPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFELE 277 + S N+P+ Y N CT+EI P KK + F E E Sbjct: 1786 IQSTNFPNNYENNEYCTWEIRVPTGKKVRLDFTELRTE 1823 >SB_25209| Best HMM Match : Astacin (HMM E-Value=7.69999e-41) Length = 533 Score = 31.9 bits (69), Expect = 0.42 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKFVEFE 283 SP YP YP+ +C ++IS P + + F++F+ Sbjct: 397 SPGYPTPYPDNTDCIWQISVPTGHRIALAFIDFD 430 >SB_32180| Best HMM Match : DUF1459 (HMM E-Value=4.8) Length = 104 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS 325 CGGN T L PNYP PN+ CT+ I+ Sbjct: 67 CGGNL--TNSTGQLTHPNYPRGMPNIGTCTWRIT 98 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAPD 316 SPNYP+ P+ + C ++I APD Sbjct: 344 SPNYPERSPSNMRCRWKIIAPD 365 >SB_9652| Best HMM Match : CUB (HMM E-Value=0.0017) Length = 78 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP 319 +PNYP YP +NCT+ I+ P Sbjct: 19 TPNYPYVYPANINCTWSITVP 39 >SB_49085| Best HMM Match : CUB (HMM E-Value=0.019) Length = 49 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIKFVEFELE 277 CGG + ++ SP YP+ YP +CT+ I+A + EI F + + Sbjct: 3 CGGRIMRANG--YILSPRYPNAYPANQDCTWIITA-SRGYEISFAFLDFQ 49 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYE-ISAPDKKTEIKFVEFELE 277 SP YP+ YPN ++C + I P ++ + F+L+ Sbjct: 723 SPRYPNPYPNNIDCVWRIIGDPSDVIRLRILAFDLQ 758 >SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 441 RWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEIS-APDKKTEI 301 R C + T+ L SP +P+ YPN ++C++ ++ +P + E+ Sbjct: 5 RLSEACSPVTVVTDWTGNLKSPEFPNNYPNNISCSWVLTVSPGNRIEV 52 >SB_27587| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 879 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -3 Query: 465 INLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIKFV 292 +N DGF+ + C G + + N+PD++ N L+ + P+ K IK++ Sbjct: 145 MNPDGFERSKELDCDGLVGRRNENNVNLNRNFPDQFNNWLDYDVSNAQPETKAVIKWI 202 >SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) Length = 614 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 429 ICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEI-SAPDKKTEIKFVEFELE 277 +C I ++ + + SP YP YP +CT I + P K + F + +E Sbjct: 49 VCPSRVITSDGGE-VTSPGYPSNYPPNTDCTLTIATGPGAKFNVMFNDLSIE 99 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 429 ICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDK-KTEIKFVEFELEGSY 268 +C I +SP +P YP C +I+ PD + + +F++ G + Sbjct: 240 VCPSRHIKYTMGGEFFSPGFPVAYPANSRCRVKITIPDNYQMNVWLTDFQIHGEW 294 >SB_4874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -3 Query: 411 IATEKEQFLYSPNYPDEYPNLLNCTYEISAP-DKKTEIKF-VEFELEGS 271 + T+ L SP YP Y N CT+ IS P + I+F ++++E S Sbjct: 24 LMTKAHGTLRSPGYPRVYSNNQRCTWHISVPRGYRIRIRFRRQYDIEES 72 >SB_23383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -3 Query: 465 INLDGFKARWDPICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISAPDKKTEIKFV 292 +N DGF+ + C G + + N+PD++ N L+ + P+ K IK++ Sbjct: 145 MNPDGFERSKELDCDGLVGRRNENNVNLNRNFPDQFNNWLDYDVSNAQPETKAVIKWI 202 >SB_34490| Best HMM Match : CUB (HMM E-Value=1.3e-07) Length = 242 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 390 FLYSPNYPDEYPNLLNCTYEI 328 ++ SP YP+ YPN ++C + I Sbjct: 153 YIQSPRYPNSYPNNMDCRWTI 173 >SB_1486| Best HMM Match : CUB (HMM E-Value=4e-10) Length = 188 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 429 ICGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISA-PDKKTEIKFVEFELE 277 +C I ++ + + SP YP YP +CT I+ P K + F + +E Sbjct: 4 VCPSRVITSDGGE-VTSPGYPSNYPPNTDCTLTIATRPGAKFNVVFNDLSIE 54 >SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 369 PDEYPNLLNCTYEISAPDKKTEIKFV-EFELEGSYPDC 259 P E P C + I+ P + E+KFV EF++ G+ DC Sbjct: 685 PAEQPE---CIWIIAVPRNRIELKFVEEFKIRGNGADC 719 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 426 CGGNFIATEKEQFLYSPNYPDEYPNLLNCTYEISA-PDKKTEIKFVEFELE 277 CG A+E + SPN+P Y CT+ +S P + F F L+ Sbjct: 906 CGSTLRASEGT--INSPNWPQGYKGSKTCTWRVSVNPSDSIALFFNSFNLQ 954 >SB_38048| Best HMM Match : CUB (HMM E-Value=1.4e-31) Length = 551 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAPDKKT-EIKFVEFELE 277 SP YP YP + C + + P T E+ +F+LE Sbjct: 187 SPFYPSNYPTNVLCKWTLVVPINYTVELNIADFQLE 222 >SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) Length = 327 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 363 EYPNLLNCTYEI-SAPDKKTEIKFVEFELEGSYPDC 259 +YP+ +CTY I + P ++ ++ F+++G P C Sbjct: 12 DYPDNSDCTYTIRTPPGTIVKLSWITFDVKGYMPTC 47 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 447 KARWDPICGGNFIATEK--EQFLYSPNYPDEYPNLLNCTYEISAPDKKTE 304 KARWD +CG + +K E L++ + D +LL+ + + P TE Sbjct: 5596 KARWDAVCGLSVERQQKLEEALLFTGMFQDALQSLLDWLFAVE-PSLSTE 5644 >SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) Length = 734 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYEISAP-DKKTEIKF 295 SP YP YP NC + I P K+ E+ F Sbjct: 27 SPGYPRGYPADANCVWTIKVPVGKRVEVIF 56 >SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30) Length = 1142 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/17 (52%), Positives = 16/17 (94%) Frame = -2 Query: 94 FDCGGHINSTTMIKSTR 44 F+CGGH+ ++T+IK+T+ Sbjct: 483 FECGGHVVNSTIIKNTQ 499 >SB_8648| Best HMM Match : C2 (HMM E-Value=0.98) Length = 273 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/17 (52%), Positives = 16/17 (94%) Frame = -2 Query: 94 FDCGGHINSTTMIKSTR 44 F+CGGH+ ++T+IK+T+ Sbjct: 208 FECGGHVVNSTIIKNTQ 224 >SB_6197| Best HMM Match : C2 (HMM E-Value=3.7e-24) Length = 569 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/17 (52%), Positives = 16/17 (94%) Frame = -2 Query: 94 FDCGGHINSTTMIKSTR 44 F+CGGH+ ++T+IK+T+ Sbjct: 377 FECGGHVVNSTIIKNTQ 393 >SB_59715| Best HMM Match : Fz (HMM E-Value=0.026) Length = 145 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 259 LFDNLTVSYAETYDYFSEVYCGKQKPPMMIGDKI 158 +F N+ +Y+ ++YC + PP G++I Sbjct: 46 IFQNILANYSSCQSDLKKIYCAELMPPCFPGEEI 79 >SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12) Length = 902 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -2 Query: 184 PPMMIGDKINLELKSDEFLTQ 122 PP IG+++++E +DEF+TQ Sbjct: 379 PPERIGEEVHVEEMNDEFVTQ 399 >SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1892 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 381 SPNYPDEYPNLLNCTYE-ISAPDKKTEIKFVEFELEGSYPDCS 256 SP YP YPN +C + + K ++ F+L S P+C+ Sbjct: 979 SPGYPGVYPNYAHCRWRFVPRFAKLLRLRIDSFDLPDS-PNCT 1020 >SB_23321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -2 Query: 202 YCGKQKP---PMMIGDKINLELKSDEFLTQKGFKIAF 101 +CG +P P G + + +SD F KGFK A+ Sbjct: 305 FCGSSRPTLRPRSTGRNMYISFRSDTFDAYKGFKAAW 341 >SB_19179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -3 Query: 510 LTNYKMKVVFRTDSDINLDGFKA---RWDPICGGNFIATEKEQFLYSPNY 370 + N K+ +VF+ DS+ N + K WDP + ++Y Y Sbjct: 1 MVNAKVSMVFKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEY 50 >SB_23834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 169 GDKINLELKSDEFLTQKGFKIAFKTFDCGGHINSTTM 59 GD + L++K DE K FKTF CG I S+++ Sbjct: 66 GDVMKLQIKVDE--QGKIIDAKFKTFGCGSAIASSSL 100 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 402 EKEQFLYSPNYPDEYPNLLNCTYEISAPDKKT-EIKFVEFELE 277 E E +SP YPN +C ++I A T +I F +F+LE Sbjct: 1157 EVEGKFHSPGGAGGYPNNSDCLWQIQASLAATVQIIFEDFDLE 1199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,428,952 Number of Sequences: 59808 Number of extensions: 367192 Number of successful extensions: 904 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -