BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1049 (573 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039042-11|AAC48251.1| 343|Caenorhabditis elegans Serpentine r... 29 2.3 AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine r... 27 7.2 >AF039042-11|AAC48251.1| 343|Caenorhabditis elegans Serpentine receptor, class h protein199 protein. Length = 343 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 35 YALLGGLRSVAQTISYEVRIALTFISSILLIICFDIYFFYLY 160 Y G + VA+ I+Y +FI S+ ++ICF++ FF+ Y Sbjct: 181 YIYDGPVYVVAEDITYH----FSFIFSLHVLICFEVIFFFGY 218 >AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine receptor, class j protein49 protein. Length = 330 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 313 FALIFLAEYSSILFIRMILVIINMGGYNLRFFFYLK 420 F L+F A ++ I + L+ I++ Y FF +LK Sbjct: 42 FLLLFFAVFNMIYSVMNFLIQIDIHSYRYCFFLFLK 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,749,460 Number of Sequences: 27780 Number of extensions: 85729 Number of successful extensions: 240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1184216096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -