BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1049 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 1.6 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 6.6 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 6.6 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 6.6 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = +2 Query: 8 IAGWSSNSNYALLGGLRSVAQTIS-----YEVRIALTFISSILLI 127 + W+S N + L +V QTIS Y++R+ F LL+ Sbjct: 19 LIAWASLENTGISDRLENVTQTISRILDGYDIRLRPNFGGEPLLV 63 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +2 Query: 509 IFTYFIKLFIIIF 547 I+ YF+ LF+II+ Sbjct: 222 IWVYFVPLFLIIY 234 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 352 FIRMILVIINMGGYNL 399 FIR++LVI+ GY L Sbjct: 54 FIRIVLVILLRAGYVL 69 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +2 Query: 509 IFTYFIKLFIIIF 547 I+ YF+ LF+II+ Sbjct: 98 IWVYFVPLFLIIY 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,303 Number of Sequences: 438 Number of extensions: 1225 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -