BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1048 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 55 8e-08 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 54 1e-07 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 54 2e-07 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 54 2e-07 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 54 2e-07 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 54 2e-07 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 54 2e-07 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 54 2e-07 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 53 3e-07 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 46 3e-05 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 37 0.018 SB_58281| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.094 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 32 0.67 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) 29 4.7 SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 29 4.7 SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) 29 4.7 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_47729| Best HMM Match : ASC (HMM E-Value=1.8e-07) 28 8.2 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -3 Query: 758 RKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 621 R +PTY+TPLMS + RLESSSTGSSFPAD KPVPLAVVSLDSR Sbjct: 85 RIATPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAVVSLDSR 130 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 489 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 385 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.5 bits (145), Expect = 4e-10 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -1 Query: 142 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGD 2 +GP PL P LRANP+ EVTD CRLPLPTLFY+ EA HLGD Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGD 70 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.5 bits (145), Expect = 4e-10 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -1 Query: 142 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGD 2 +GP PL P LRANP+ EVTD CRLPLPTLFY+ EA HLGD Sbjct: 63 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGD 110 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/52 (57%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -2 Query: 153 PDPAPXRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 P PAP R+ + + EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 19 PRPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.8 bits (126), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL+PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2 Query: 108 TPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 T + EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 249 TDPTLEPILFPKLRIYFADFPYLHCSINQRLLTLET 284 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 114 PDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 P + EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLET 121 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTLET 208 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLET 142 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLET 64 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLET 142 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLET 142 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLET 76 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTLET 211 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTLET 79 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S +PIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTLET 181 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLET 142 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 111 EPILFPKLRIYFADFPYLHCSINQRLLTLET 141 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLET 764 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLET 142 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLET 70 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 60 EPILFPKLRIYFADFPYLHCSINQRLLTLET 90 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLET 180 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLET 76 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTLET 221 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLET 180 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTLET 167 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 144 APXRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +P R+ + + +PIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 21 SPGRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTLET 68 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLET 108 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLET 108 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLET 107 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLET 58 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLET 69 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTLET 69 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL KLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTLET 69 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 4e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH +I+ RL TLET Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTLET 82 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI F DFPYLH SI+ RL TLET Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTLET 69 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 51.6 bits (118), Expect = 8e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 102 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 +S EPIL KLRI FADFPYLH SI+ RL TLET Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTLET 69 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 93 EPILIPKLRIQFADFPYLHYSID*RLFTLET 1 EPIL PKLRI FADFPYLH SI+ RL LET Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKLET 69 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 559 MPRHLISDAHEWINEIPTVPYL 624 MPRHLISDAHEWINEIPTVP + Sbjct: 1 MPRHLISDAHEWINEIPTVPII 22 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -2 Query: 153 PDPAPXRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RL 16 P +P R+ + + EPIL PKLRI FADFPYLH SI+ RL Sbjct: 31 PSASPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRL 77 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -2 Query: 126 FPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLET 1 F ++ P + P +LRI FADFPYLH SI+ RL TLET Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLET 41 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 72 LRIQFADFPYLHYSID*RLFTLET 1 LRI FADFPYLH SI+ RL TLET Sbjct: 1 LRIYFADFPYLHVSINQRLLTLET 24 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 72 LRIQFADFPYLHYSID*RLFTLET 1 LRI FADFPYLH SI+ RL TLET Sbjct: 1 LRIYFADFPYLHCSINQRLLTLET 24 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 72 LRIQFADFPYLHYSID*RLFTLET 1 LRI FADFPYLH SI+ RL TLET Sbjct: 1 LRIYFADFPYLHCSINQRLLTLET 24 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 72 LRIQFADFPYLHYSID*RLFTLET 1 LRI FADFPYLH SI+ RL TLET Sbjct: 2 LRIYFADFPYLHCSINQRLLTLET 25 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 72 LRIQFADFPYLHYSID*RLFTLET 1 LRI FADFPYLH SI+ RL TLET Sbjct: 1 LRIYFADFPYLHCSINQRLLTLET 24 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 142 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLPL 44 +GP PL P LRANP+ EVTD CRLPL Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPL 56 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 IQFADFPYLHYSID*RLFTLET 1 I FADFPYLH SI+ RL TLET Sbjct: 4 IYFADFPYLHVSINQRLLTLET 25 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 66 IQFADFPYLHYSID*RLFTLET 1 I FADFPYLH SI+ RL TLET Sbjct: 10 IYFADFPYLHCSINQRLLTLET 31 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -2 Query: 78 PKLRIQFADFPYLHYSID*RLFTLET 1 P++ FADFPYLH SI+ RL TLET Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTLET 70 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 142 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLP 47 +GP PL P LRANP+ EVTD P Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFADFP 55 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 142 TGPHPLPVQTRHA-PVLRANPYSEVTDPICRLP 47 +GP PL P LRANP+ EVTD CRLP Sbjct: 127 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLP 159 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 78 PKLRIQFADFPYLHYSID*RLFTLET 1 P++ F PYLH SI+ RL TLET Sbjct: 149 PEVTDLFCRLPYLHCSINQRLLTLET 174 >SB_58281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 34.7 bits (76), Expect = 0.094 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +2 Query: 383 QNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQQARVN-GGSNYDSLKVAK 559 +N++G+ + CL + D +GC R+++ + R + +A +N G +NYD++ + + Sbjct: 530 ENYNGEDGAPCLFPSNWIDASQGCYRSLVFHAFASSLRHFLARALMNEGHTNYDAMTLVQ 589 Query: 560 CLV 568 +V Sbjct: 590 EIV 592 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 497 EEIQQARVNGGSNYDSL 547 ++ QARVNGGSNYDSL Sbjct: 35 KKFNQARVNGGSNYDSL 51 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 380 LTVERRSYRIVPIAHETKPTRPYG*EDPRKA-GERGSGSSPKRRRFSRVSY 231 L+V R Y++VP++HE + R A +GSGSSP R V+Y Sbjct: 1038 LSVSGRCYKVVPLSHELCLVSKSLWNNRRSADNPKGSGSSPTRDTTLIVTY 1088 >SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) Length = 734 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 113 PTRPGPQSQSLFRSYGSNLPTSLTYIILSTRGSSP 9 P+RPG + SL S ++ P S T L +R SSP Sbjct: 488 PSRPGSSAVSLLASCATSQPGSRTVSPLVSRASSP 522 >SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 235 HIKYIQFLRPHYIKILTR*--NEHNARTSTRPGTGPHPLPVQTRHAP 101 H + I+ +RP + L R + H + T T G HP+PV T P Sbjct: 239 HKQEIRDVRPSLVTDLARHAGSPHVSATPTAAGVSAHPIPVATSKVP 285 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 178 NEHNARTSTRPGTGPHPLPVQTRHAPVLRANP 83 +E +A TRPG P P+P Q + P + P Sbjct: 588 HERSAGPVTRPGKRPSPVPQQNKEPPSKKPKP 619 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,013,014 Number of Sequences: 59808 Number of extensions: 602590 Number of successful extensions: 2049 Number of sequences better than 10.0: 255 Number of HSP's better than 10.0 without gapping: 1869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2048 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -