BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1047 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 3.4 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 362 VPYILVNGKESSIYAFILDVCNAFINPPPHCVNAF-YSVT 478 V Y+LV + F D N +I P P+ F Y +T Sbjct: 213 VAYLLVGSLKGIARQFYNDDANVYILPDPYNTKFFRYRIT 252 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 113 LFGTVLADKLV-LTILFYGLGFSVRVDINV 27 +F T D + L I+ YG+GF + DI + Sbjct: 497 IFDTYTYDTICQLNIVHYGIGFITQSDIEL 526 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,616 Number of Sequences: 438 Number of extensions: 4014 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -