BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1043 (778 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 3.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 3.6 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 344 IKVLHLQFLHRGMHLAGRWIHW*EPSCLGRLLRSGIEA 457 + VL + + G + R + W EP L RL+ G+ + Sbjct: 70 VDVLLQEAVFEGTNRKNRVLQWREPEELRRLMDFGVRS 107 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 45 LKNSHENNPPSAFFCCKSREPV*NMYYH 128 LKN ++P C+ EP YYH Sbjct: 97 LKNPSLSSPDECARACREGEPPRICYYH 124 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 489 SATMRRKSLPGIVAPS*TARATYRGSPEQSC 581 SAT P + +P ARA G P + C Sbjct: 91 SATAELLKNPSLSSPDECARACREGEPPRIC 121 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 45 LKNSHENNPPSAFFCCKSREPV*NMYYH 128 LKN ++P C+ EP YYH Sbjct: 97 LKNPSLSSPDECARACREGEPPRICYYH 124 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 489 SATMRRKSLPGIVAPS*TARATYRGSPEQSC 581 SAT P + +P ARA G P + C Sbjct: 91 SATAELLKNPSLSSPDECARACREGEPPRIC 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,897 Number of Sequences: 336 Number of extensions: 4588 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -