BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1002 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 0.85 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 0.85 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.0 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 591 PLPVPSPDEKRGGLASVCHLPGRKNITPSNGWRSTNP 701 P P+ SP+ + +A+ H P ++P G+RS P Sbjct: 173 PYPILSPEMSQ--VAASWHTPSMYPLSPGAGFRSPYP 207 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 591 PLPVPSPDEKRGGLASVCHLPGRKNITPSNGWRSTNP 701 P P+ SP+ + +A+ H P ++P G+RS P Sbjct: 65 PYPILSPEMSQ--VAASWHTPSMYPLSPGAGFRSPYP 99 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 513 CYVKYTSMVLF*-LVYYAYSAIIIITLPL 596 C +T +LF +YY YSA II T+ L Sbjct: 198 CLDYFTLHLLFLPCIYYFYSAFIIFTIHL 226 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 630 LASVCHLPGRKNITPSNGWRSTNP 701 LAS L G N PSNG S+ P Sbjct: 64 LASGSSLNGLTNNVPSNGLSSSGP 87 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 297 FSNCICCCNASLITKLFRWLLNYFLCVSSYI 205 F N + CN + L+RW++ Y L S + Sbjct: 149 FLNFMLHCNNTTWRCLYRWIVLYTLSKMSQV 179 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 110 SNVFSVNDFVY 78 SNVF +N FVY Sbjct: 611 SNVFRMNQFVY 621 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,194 Number of Sequences: 336 Number of extensions: 4643 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -