BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1002 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35460.1 68415.m04344 harpin-induced family protein / HIN1 fa... 30 1.9 At5g41390.1 68418.m05029 hypothetical protein contains 1 predict... 29 3.3 >At2g35460.1 68415.m04344 harpin-induced family protein / HIN1 family protein / harpin-responsive family protein similar to harpin-induced protein hin1 ( GI:1619321) [Nicotiana tabacum]; Length = 238 Score = 29.9 bits (64), Expect = 1.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 300 CFSNCICCCNASLITKLFRWLLNYFLCV 217 CFS+C+ CC L+ + L+ +C+ Sbjct: 38 CFSSCLLCCGGCLVNIICNILIGVLVCL 65 >At5g41390.1 68418.m05029 hypothetical protein contains 1 predicted transmembrane domain; Length = 297 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 312 NTPVCFSNCIC--CCNASLITKLFRWLLNYFLCVSSYIRCSKK 190 +TP CF +C+C C + L + ++ + C Y+ CS K Sbjct: 32 DTPYCFFSCLCGPCVSYLLRKRALYNDMSRYTCCGGYMPCSGK 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,153,688 Number of Sequences: 28952 Number of extensions: 346292 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -