BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1001 (490 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 0.60 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.4 AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 22 9.8 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 22 9.8 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 0.60 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Frame = +1 Query: 73 RTLDVRSGRMKL-SSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEV 234 RT V +G ++ SY +D + T E +SV G +LGP W TM G +++ Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDI 647 Query: 235 RGNPD 249 PD Sbjct: 648 ALPPD 652 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 7.4 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 176 SEHKCWDPKDGELCLVRSKSGETLMEAVAILTCKSIVGTG 295 S+ +C+ PK E C + G T L CK+ G Sbjct: 189 SQGRCFGPKPRECCHLFCAGGCTGPTQSDCLACKNFYDDG 228 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 22.2 bits (45), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 167 KARSEHKCWDPKDGELCL 220 +A S H+CW + EL L Sbjct: 122 RAYSHHRCWKETEPELRL 139 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 302 PYTQFRRSICTSESLRPPSGFP 237 P+T F RSIC E S P Sbjct: 260 PFTDFLRSICLPEQNFESSATP 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,888 Number of Sequences: 2352 Number of extensions: 8995 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -