BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1001 (490 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68117-1|CAA92181.2| 459|Caenorhabditis elegans Hypothetical pr... 30 0.78 AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical ... 28 4.2 AF068716-7|AAC17746.1| 384|Caenorhabditis elegans Hypothetical ... 27 9.7 >Z68117-1|CAA92181.2| 459|Caenorhabditis elegans Hypothetical protein F45E6.3 protein. Length = 459 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 51 KGVTKVKANARRSLREDEIIELRSRFSHSRGVSFPIS 161 K ++++ + RR E + +L SRF H G+ +P+S Sbjct: 116 KVLSQIDKDVRRLYPEIQFFQLLSRFPHQHGMKYPLS 152 >AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical protein C53D5.5 protein. Length = 642 Score = 27.9 bits (59), Expect = 4.2 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +2 Query: 164 MKARSEHKCWDPKDGELCLVRSKSGETLMEAVA-----ILTCKSIVGTGYRGERL---IE 319 M ++S ++ K EL V G T++ VA L K+ V R+ ++ Sbjct: 521 MSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQ 580 Query: 320 PSSSWFRPKFPSG*LASI 373 P+ +W+ P FP + S+ Sbjct: 581 PNYTWYEPNFPKAYVKSL 598 >AF068716-7|AAC17746.1| 384|Caenorhabditis elegans Hypothetical protein F26D11.2 protein. Length = 384 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 85 VRSGRMKLSSY-VRDFRTPEASRFQSVN 165 ++S R++ + Y VR F PE +RF S+N Sbjct: 327 IKSFRVETADYTVRAFADPEKTRFSSIN 354 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,725,040 Number of Sequences: 27780 Number of extensions: 218961 Number of successful extensions: 419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 914086948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -