BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0982 (275 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharo... 26 1.1 SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce... 25 1.5 SPBC25H2.14 |mug16||UNC-50 family protein|Schizosaccharomyces po... 24 4.6 SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomy... 23 6.1 SPAC637.04 |||Cargo-transport protein Ypp1 |Schizosaccharomyces ... 23 8.0 >SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 178 GIYIHTCIEKFYQMT*NXXXXXXXXXNKW 264 G YIHTC + Y+ T + NKW Sbjct: 217 GYYIHTCPKMKYKATYSPSYLLNPGTNKW 245 >SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1666 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 131 YKYTYFYNNECDLSSK*IN 75 Y Y YF N +C++ SK +N Sbjct: 1589 YAYPYFINFQCEMFSKVLN 1607 >SPBC25H2.14 |mug16||UNC-50 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 235 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/43 (25%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 75 INSF-RR*VAFVIVKICILIGSTTSYSLFWLNHYFRYIYTYLY 200 IN + R +F+++ C+++ S ++LF++N Y+ T + Sbjct: 47 INRYGREDFSFIVLFSCMIVISALLWALFYMNTPKGYVTTITF 89 >SPBC660.14 |mik1||mitotic inhibitor kinase Mik1|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 25 TPCKVAPFFIIHSFINS 75 TPCK P F+ S +N+ Sbjct: 231 TPCKSQPIFLSSSHVNN 247 >SPAC637.04 |||Cargo-transport protein Ypp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 862 Score = 23.0 bits (47), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 185 IYILVLRNFIK*HEIFDYFFNISS 256 +Y LRN K EI DY I+S Sbjct: 414 VYAQYLRNLKKVSEILDYITKIAS 437 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,108,991 Number of Sequences: 5004 Number of extensions: 19726 Number of successful extensions: 42 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 2,362,478 effective HSP length: 61 effective length of database: 2,057,234 effective search space used: 61717020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -