BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0970 (468 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po... 31 0.088 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 27 1.9 SPBC365.02c |cox10||protoheme IX farnesyltransferase|Schizosacch... 25 5.8 SPAC23H4.10c |thi4||thiamine-phosphate dipyrophosphorylase/hydro... 25 5.8 SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr... 25 7.6 >SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 31.1 bits (67), Expect = 0.088 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -2 Query: 386 HNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTRE 279 +++ YN+ M TS+C+C++ + YGGN A E Sbjct: 47 YSSTYNEITNMDTSSCSCSSTPK-SYGGNLAPFDEE 81 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 26.6 bits (56), Expect = 1.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 389 AHNTKYNQYLKMSTSTCNCNARDRVVYGGNSA 294 +HN +N + + S ++ + +R+ V+ GNS+ Sbjct: 616 SHNEMFNSFHRSSVTSASIKSREAVLSAGNSS 647 >SPBC365.02c |cox10||protoheme IX farnesyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 25.0 bits (52), Expect = 5.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 407 NRVYFKAHNTKYNQYLKMSTSTCNCNA 327 +R +F + KYN+ + TST NA Sbjct: 35 SRTFFSPTHIKYNRLSTLDTSTSTANA 61 >SPAC23H4.10c |thi4||thiamine-phosphate dipyrophosphorylase/hydroxyethylthiazole kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 518 Score = 25.0 bits (52), Expect = 5.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 182 TPRETARPLDTTVKSPVFLKSTRGSLHLSK 93 TPRETA+ L + +P R SL K Sbjct: 207 TPRETAKELRNLIATPPCFAQARSSLTTPK 236 >SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 599 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 298 LLPPYTTRSRALQLQVDVLIFKYWLYL 378 L PP T +R L Q+D L++ + YL Sbjct: 299 LTPPSLTDTRQLMQQLDQLLYTLFSYL 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,645,783 Number of Sequences: 5004 Number of extensions: 29801 Number of successful extensions: 100 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -