BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0970 (468 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8264| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-06) 28 3.4 SB_9107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_16098| Best HMM Match : Abhydrolase_1 (HMM E-Value=4.5e-22) 27 7.7 >SB_8264| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-06) Length = 309 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 229 LQPRIQRCLGA-RYDRERLGRPQGRWT 152 LQPRI RC GA RYD + R GR T Sbjct: 210 LQPRISRCPGARRYDMHK-ARESGRET 235 >SB_9107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 217 IQRCLGARYDRERLGRPQGRW 155 IQR L + DR+ LGR Q RW Sbjct: 22 IQRFLSSTNDRDLLGRQQSRW 42 >SB_16098| Best HMM Match : Abhydrolase_1 (HMM E-Value=4.5e-22) Length = 863 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 441 RQLEVHYLVGEQQSVLQGPQH*VQPVLEDEYVDLQLQR 328 RQ+ + ++VG + V + ++ + ED +VD+Q+ R Sbjct: 786 RQVPISFIVGARSWVNNESSYEIKRIREDSFVDIQVIR 823 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,405,585 Number of Sequences: 59808 Number of extensions: 221860 Number of successful extensions: 827 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -