BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0970 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 7.0 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 23 7.0 AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. 22 9.3 AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. 22 9.3 AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. 22 9.3 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 22.6 bits (46), Expect = 7.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 262 GWKNHCS 282 GWKNHC+ Sbjct: 123 GWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 22.6 bits (46), Expect = 7.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 262 GWKNHCS 282 GWKNHC+ Sbjct: 123 GWKNHCN 129 >AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.2 bits (45), Expect = 9.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 88 GRLERCNEPRVDFRKTGDFTVVSNGLAVSRGV 183 G C P+V D S+GLAVSR V Sbjct: 104 GNYHECYMPQVIHVSREDQLKDSSGLAVSRAV 135 >AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.2 bits (45), Expect = 9.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 88 GRLERCNEPRVDFRKTGDFTVVSNGLAVSRGV 183 G C P+V D S+GLAVSR V Sbjct: 104 GNYHECYMPQVIHVSREDQLKDSSGLAVSRAV 135 >AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.2 bits (45), Expect = 9.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 88 GRLERCNEPRVDFRKTGDFTVVSNGLAVSRGV 183 G C P+V D S+GLAVSR V Sbjct: 104 GNYHECYMPQVIHVSREDQLKDSSGLAVSRAV 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,388 Number of Sequences: 2352 Number of extensions: 7991 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -