BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0970 (468 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20020.1 68416.m02533 protein arginine N-methyltransferase fa... 31 0.51 At3g03405.1 68416.m00338 hypothetical protein temporary automate... 28 2.7 At4g16050.1 68417.m02435 expressed protein 27 6.3 At1g31010.1 68414.m03797 expressed protein contains Pfam PF05329... 27 6.3 At4g09520.1 68417.m01565 2,3-biphosphoglycerate-independent phos... 27 8.4 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 27 8.4 >At3g20020.1 68416.m02533 protein arginine N-methyltransferase family protein similar to SP|Q96LA8 Protein arginine N-methyltransferase 6 (EC 2.1.1.-) {Homo sapiens} Length = 435 Score = 30.7 bits (66), Expect = 0.51 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 139 DFTVVSNGLAVSRGVHDR-IELQGIVEFAVVDEEQDVVFVLAGWKNHCSLVLSALLPPYT 315 D V + + + G+ D+ I L G VE +DEE DV +++ W + L S L T Sbjct: 151 DIAVQAKEVVKANGLSDKVIVLHGRVEDVEIDEEVDV--IISEWMGYMLLYESMLGSVIT 208 Query: 316 TRSRALQ 336 R R L+ Sbjct: 209 ARDRWLK 215 >At3g03405.1 68416.m00338 hypothetical protein temporary automated functional assignment Length = 193 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 196 ELQGIVEFAVVDEEQDVVFVLAGWKNHCSLVL 291 E+ ++E ++DEE+ VV V G+K+ S +L Sbjct: 103 EVSLVLESFIIDEEKKVVMVSEGFKHRISYIL 134 >At4g16050.1 68417.m02435 expressed protein Length = 666 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 222 REFNDALELDTIVNASGDRKAVGHDGEVSGLPE 124 + N + D I N G+R + D VSGLP+ Sbjct: 549 QRINSRKKSDDIENTEGERSRLVADNNVSGLPQ 581 >At1g31010.1 68414.m03797 expressed protein contains Pfam PF05329: Protein of unknown function (DUF731) Length = 360 Score = 27.1 bits (57), Expect = 6.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 356 MSTSTCNCNARDRVVYGGNSADSTREQW 273 +STS+ ++R R GGN A+ + E+W Sbjct: 32 LSTSSTESSSRTRGGGGGNRAEKSSEEW 59 >At4g09520.1 68417.m01565 2,3-biphosphoglycerate-independent phosphoglycerate mutase family protein / phosphoglyceromutase family protein contains similarity to 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (aPGAM 1) (aPGAM-Mj1). (Swiss-Prot:Q59007) [Methanococcus jannaschii]; contains weak hit to Pfam profile PF01676: Metalloenzyme superfamily Length = 492 Score = 26.6 bits (56), Expect = 8.4 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 109 EPRVDFRKTGDFTVVSNGLAVSRGVHDRIELQGIVEFAVVDEEQDVV 249 +PRV +R G F + GLA+S G ++ FA +DE+ VV Sbjct: 72 DPRVYYRGRGAFESMGAGLAMSPG-----DIAFKSNFATLDEDSGVV 113 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 26.6 bits (56), Expect = 8.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 246 DVLFFIYNREFNDALEL 196 D LFF YN+E ND E+ Sbjct: 217 DTLFFQYNKELNDVREI 233 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,548,848 Number of Sequences: 28952 Number of extensions: 152640 Number of successful extensions: 469 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 791932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -