BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0951 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 35 0.002 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.0 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 25 2.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.7 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 35.1 bits (77), Expect = 0.002 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 137 KATPENIARAKIIIDRLEANGGTNIDAALGTAIDLIR 247 +ATP+N+ K I+ +E N AAL TA +L+R Sbjct: 327 RATPDNVKEVKTAINAVECENTANFSAALETAFELLR 363 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.2 bits (55), Expect = 1.0 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +1 Query: 226 YCHRSNQEQIELFANSTSSNKDEILSLEPI 315 + H++N +++L+AN +S + L L+P+ Sbjct: 671 FTHKTNLTRVDLYANQLTSLDIKALRLQPV 700 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 497 RAKPLLRSDNLRRSLGSASSPKASENIVA 411 + KP+L D RS+ A PK+ E VA Sbjct: 111 KQKPVLMMDGAPRSVVKAKHPKSQERKVA 139 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +1 Query: 142 DSGEYSTS*DHHRQT*SKRRYQH*CCARYCHRSNQEQIELFANSTS 279 D G+ + DHH+ +++ QH + H +Q + F N+ + Sbjct: 631 DVGQKADQTDHHQSQQPQQQQQHQHHHHHHHHHHQNPNDHFVNTNT 676 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,789 Number of Sequences: 2352 Number of extensions: 14563 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -