BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0950 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 25 0.42 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 1.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 6.8 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 25.0 bits (52), Expect = 0.42 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 414 ECKQSIFRRRAGHSRGSCRPTRRSTVGFLLKHTD 313 +C S R+ +G+C+ R VG+ LK D Sbjct: 61 QCSNSPLRKARYTEKGTCKMGREIEVGYDLKSPD 94 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.0 bits (47), Expect = 1.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 84 IGRVFSFEGLPIRRLH 37 + + SFE LP RRLH Sbjct: 47 VSKPVSFESLPNRRLH 62 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 144 LHSFVHICFVGMLDLSYNLAI 82 LH F C++ +L L N+A+ Sbjct: 169 LHEFYGFCYLWVLILICNIAL 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,188 Number of Sequences: 336 Number of extensions: 3039 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -