BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0945 (760 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1023 - 23710825-23710950,23711037-23711120,23711367-237114... 33 0.33 03_01_0249 - 1935355-1935827,1936129-1936330 32 0.57 11_06_0734 - 26774471-26774652,26775008-26775137,26775447-267755... 31 0.75 12_02_0674 - 21745321-21746223,21746229-21747608 29 3.0 11_04_0306 + 16176873-16177124,16178155-16179152,16179204-161793... 29 3.0 10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304,982... 29 4.0 06_03_0403 - 20435349-20435358,20435750-20436204,20436744-20438315 29 4.0 02_03_0134 - 15596379-15597689 29 4.0 07_03_0352 + 17089666-17089982,17090326-17090410,17090674-17090913 28 7.0 05_04_0191 + 18927302-18927707,18928747-18928979,18929062-189291... 28 7.0 12_02_1120 - 26228618-26229403 28 9.3 06_03_1404 - 29928792-29929040,29929147-29929551,29930130-299302... 28 9.3 02_02_0467 - 10620976-10621299 28 9.3 01_01_0639 + 4825703-4826155,4826344-4826559,4826683-4827411 28 9.3 >08_02_1023 - 23710825-23710950,23711037-23711120,23711367-23711492, 23711593-23711712,23712046-23712153,23712243-23712395, 23712505-23712600,23712716-23712800,23713278-23714268, 23714870-23714915,23715806-23715964,23716516-23716651, 23716734-23716900,23717366-23717696,23717827-23718062, 23718326-23718514 Length = 1050 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = -2 Query: 411 FKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSW-YSPLRTGYLPPFNSFF--IHLP 241 F G ++ YQ++L Y++ L + K EFS Y P RT Y FN F +HL Sbjct: 487 FNNDLGLVFVAVYQRMLHLLYVDDLLAAVRK--EFSQIYDPKRTSYDDAFNEVFRQLHLE 544 Query: 240 KEA 232 EA Sbjct: 545 AEA 547 >03_01_0249 - 1935355-1935827,1936129-1936330 Length = 224 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = -1 Query: 280 LPPAFQLLFYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDK 119 L AFQL F PF R+ D + + + ++ LD+YE Q+L + + A D+ Sbjct: 118 LAMAFQLAFAPFMGRATDMAVVEQNEAKLVKVLDVYE----QWLGENQYFAGDE 167 >11_06_0734 - 26774471-26774652,26775008-26775137,26775447-26775596, 26775685-26775918,26775990-26776161,26776285-26776506, 26776604-26776770,26776880-26777018,26777342-26777693, 26778175-26778370 Length = 647 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -2 Query: 522 QQRRQIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLL 361 ++ R I + G+ FH LP W +GKYG +K + YF + +L+ Sbjct: 236 ERYRWIIQRVREYGMKVMLTLFHHSLPPW--AGKYGGWKMEKTVTYFMDFVRLV 287 >12_02_0674 - 21745321-21746223,21746229-21747608 Length = 760 Score = 29.5 bits (63), Expect = 3.0 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = -2 Query: 228 TTSCT-PRRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPI 52 +T+CT P T SST S ++SK +S PST L + K T T TP Sbjct: 574 STTCTSPLSTATGKTSSTPSTSPLSTSTSKTSSTPSTSPLSSSTIKIPTTARTGELSTPT 633 Query: 51 YSKKTSSNSTSVLT 10 T++ + + T Sbjct: 634 DKIPTTTRAGDLST 647 >11_04_0306 + 16176873-16177124,16178155-16179152,16179204-16179339, 16179448-16179597,16179711-16179891,16181139-16181298, 16182156-16182378 Length = 699 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 165 HSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 49 H TS+ + PSTK L+C+ +Q+ L + R P+Y Sbjct: 583 HLDTTSTSINLHPSTKLLLCS-QEQAGLKFSLSRACPLY 620 >10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304, 9826387-9826476,9826706-9826756 Length = 428 Score = 29.1 bits (62), Expect = 4.0 Identities = 24/72 (33%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Frame = -2 Query: 273 PPFNSFFIHLPKEAMTTSCTPRR-TTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVA 97 PP H P A TPRR T ASS R SS++SS S ++ T A Sbjct: 16 PPLAPAAAHAPNSAAAACSTPRRGKTSPHASS---RHASSSSSSSSLPSCSAARVAVTPA 72 Query: 96 KQSTLWATTGRR 61 +T A R Sbjct: 73 PHATATAPVTMR 84 >06_03_0403 - 20435349-20435358,20435750-20436204,20436744-20438315 Length = 678 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 162 SSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIYSKKTSSNSTSV 16 +S ++S ++RP+T CT A T +P +K+TSS S+SV Sbjct: 635 ASRSASPTSARPATSSWTCTS-------AATASASPATAKRTSSTSSSV 676 >02_03_0134 - 15596379-15597689 Length = 436 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = -2 Query: 225 TSCTPRRTTKKFASSTFMRRHSSNTS----SKVTSRPSTKKLICTVAKQSTLWATTG 67 +S P T + SS M R + ++S S ++SRP K+ + AKQ T AT G Sbjct: 113 SSVWPPALTARNRSSKDMNRTAKSSSAMQKSNLSSRPGVDKMAASSAKQRTQKATPG 169 >07_03_0352 + 17089666-17089982,17090326-17090410,17090674-17090913 Length = 213 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +1 Query: 199 RSSSRCATRSHCFFGQM-----DKKGVERREVASSKRRVPGKLRDFTQSIG 336 RS ++ R HCFF + K+G E A ++ PGK R T+ IG Sbjct: 34 RSQAKVWFRRHCFFQSLVRARDQKRGSESNSGAEKEKLTPGKKR--TRRIG 82 >05_04_0191 + 18927302-18927707,18928747-18928979,18929062-18929127, 18929262-18929340,18929935-18930014,18930099-18930122, 18930254-18930375,18930902-18931109,18931960-18932006, 18932914-18932998,18933292-18933355,18933488-18933609 Length = 511 Score = 28.3 bits (60), Expect = 7.0 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 Query: 611 DEKICYNYGIIKENEQFVM 555 DE +C+ YG ++ENE +++ Sbjct: 459 DEVLCWLYGTVRENEDYIL 477 >12_02_1120 - 26228618-26229403 Length = 261 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/77 (25%), Positives = 35/77 (45%) Frame = -2 Query: 231 MTTSCTPRRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPI 52 +T S RTT R HSS+ + +T P ++ V ++ L T R P Sbjct: 153 LTASSEAERTTTMARRRRRSRSHSSHHALMMTP-PVVQEKSIVVVREEKLRRTATERPPE 211 Query: 51 YSKKTSSNSTSVLTRLT 1 ++ ++ S+S +RL+ Sbjct: 212 PEEEMTTTSSSEYSRLS 228 >06_03_1404 - 29928792-29929040,29929147-29929551,29930130-29930280, 29930363-29930501,29930578-29930743,29930826-29931041, 29931142-29931323,29931412-29931538,29931974-29932112, 29932227-29932353,29932501-29932612,29932704-29932784, 29933330-29933483,29933569-29933689,29934003-29934045, 29934356-29934460 Length = 838 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 241 QRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAF 125 ++S E T+KNYE I F D ++ QYL K F Sbjct: 607 EKSPFLERLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKF 645 >02_02_0467 - 10620976-10621299 Length = 107 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Frame = +1 Query: 199 RSSSRCATRSHCFFGQM-----DKKGVERREVASSKRRVPGKLRDFTQSIGKTLHV 351 RS ++ R HCFF + K+G E A ++ PGK R + +L + Sbjct: 22 RSQAKVWFRRHCFFQSLVRARDQKRGSESNSGAEKEKLTPGKKRGTRIGLAASLSI 77 >01_01_0639 + 4825703-4826155,4826344-4826559,4826683-4827411 Length = 465 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = +1 Query: 130 P*SDLAGGIGRMSSHKCRGSEFLRSSSRCATRSHCFFGQMDKKGVERREVASSKRRVP 303 P + GG G +S CRG SS RS Q + GV +++RVP Sbjct: 350 PTKSVCGGGGYGASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGGGARKRVP 407 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,995,952 Number of Sequences: 37544 Number of extensions: 392346 Number of successful extensions: 1035 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -