BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0939 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to A... 32 0.34 At3g08630.1 68416.m01002 expressed protein 28 7.4 >At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to ATPase subunit 6 GI:515963 from [Raphanus sativus]; contains Pfam profile: PF00119 ATP synthase, A subunit Length = 385 Score = 32.3 bits (70), Expect = 0.34 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Frame = +1 Query: 514 TLAVRLTANIIAGHLLITLLRRTG-----TNISFY--XXXXXXXXXXXXXXXESAVAIIQ 672 +L +RL AN++AGH L+ +L N FY E VAI+Q Sbjct: 307 SLGIRLFANMMAGHSLVKILSGFAWTMLCMNDIFYFIGALGPLFIVLALTGLELGVAILQ 366 Query: 673 SYVITILRTLYYSE 714 +YV TIL +Y ++ Sbjct: 367 AYVFTILICIYLND 380 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 502 YSTGTLAVRLTANIIAGHLLITLLRRTGT 588 + T +A+R+ N++ G +TL R TG+ Sbjct: 290 FKTSVIALRVVNNVLGGMSFVTLARMTGS 318 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,186,794 Number of Sequences: 28952 Number of extensions: 131917 Number of successful extensions: 238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 238 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -