BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0925 (493 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK097463-1|BAC05064.1| 209|Homo sapiens protein ( Homo sapiens ... 32 0.94 >AK097463-1|BAC05064.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40144 fis, clone TESTI2013012. ). Length = 209 Score = 32.3 bits (70), Expect = 0.94 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 208 PGISKRTFLKLWQKHVQMYSSPETSIQTFP*SRQGQATSRIRSL 339 PG+ +RT + LW MY +S+ FP + G + +R ++L Sbjct: 43 PGLPRRTHIHLWPHSAHMYFLVTSSLLPFPLIQPGCSRTRFKTL 86 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,224,582 Number of Sequences: 237096 Number of extensions: 1370907 Number of successful extensions: 3700 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3700 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4423060356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -