BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0919 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0223 - 26525618-26526112,26526203-26526370,26526649-265274... 29 4.7 08_02_0775 + 21070898-21071290,21071406-21071504,21075103-210751... 28 6.2 >05_06_0223 - 26525618-26526112,26526203-26526370,26526649-26527473, 26527898-26528004,26529701-26529767 Length = 553 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 15 YFFPNV*TSNGSFVKLEKFRLTEIAFRPSMCTGCTR 122 Y FP S GS L+ L AFRP GC+R Sbjct: 170 YSFPCSLLSGGSGRSLQHLELVNCAFRPMAGLGCSR 205 >08_02_0775 + 21070898-21071290,21071406-21071504,21075103-21075126, 21076344-21076391,21076536-21076788,21076945-21077055, 21077544-21077680,21077778-21077891,21077982-21078181, 21078268-21078516,21078730-21078886 Length = 594 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +2 Query: 44 WLFCEVGKISLNRNSFSPFDVYRVYQKEWL-----ILKHLIVEILGTQK 175 W F VG + + S F YR Q W + K ++VEIL +K Sbjct: 346 WKFVYVGDVKVKSELPSTFKAYRFQQHRWSCGPANLFKKMMVEILENKK 394 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,810,400 Number of Sequences: 37544 Number of extensions: 308473 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -