BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0915 (325 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch... 27 0.93 SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz... 25 2.1 SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccha... 25 2.1 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 3.7 SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizos... 24 4.9 SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 24 4.9 SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe... 24 4.9 SPBC1604.05 |pgi1||glucose-6-phosphate isomerase |Schizosaccharo... 24 4.9 SPAC2F3.13c |||queuine tRNA-ribosyltransferase |Schizosaccharomy... 24 4.9 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 23 8.6 SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb... 23 8.6 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 23 8.6 SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 23 8.6 SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces pom... 23 8.6 >SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1316 Score = 26.6 bits (56), Expect = 0.93 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 189 HSKRETRRRSPFGSRRSMLSVFS*HVHHGSEGPDITQFDV 308 +S RET PF SR+ +S S ++ G P I +++ Sbjct: 527 NSFRETESPKPFLSRQIGISTLSSNISSGKGTPSIQDYEI 566 >SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 100 LASALEAFRHNPADGSSHHRPLGRVHEPNVR 8 LA +A R+NP+ G+ H R R+ + VR Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86 >SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 100 LASALEAFRHNPADGSSHHRPLGRVHEPNVR 8 LA +A R+NP+ G+ H R R+ + VR Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 24.6 bits (51), Expect = 3.7 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 51 ELPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 164 E +A A +AEA E+ K+++ EP+++ +K+ Sbjct: 93 EAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130 >SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 100 LASALEAFRHNPADGSSHHRPLGRVHEPNVR 8 LA +A R+NP+ G+ H R R+ VR Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFTKAVR 86 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 24.2 bits (50), Expect = 4.9 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 141 RESGGSKQCD---FTSRVSHSKRETRRRSPFGSRRSMLSVFS*HVHHGSEGPD 290 RE GG D SR S S E R RSP+ RS S S PD Sbjct: 100 RERGGRVHGDSGRLRSR-SPSPHEARSRSPYNDERSDRRSMSPRYRSRSRSPD 151 >SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 209 TSKPIWIAEIDAIGFFLTRASRLR 280 TS+P+++A G+F T AS L+ Sbjct: 163 TSRPVYLAVPSDAGYFYTDASPLK 186 >SPBC1604.05 |pgi1||glucose-6-phosphate isomerase |Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 24.2 bits (50), Expect = 4.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 73 HNPADGSSHHRPL 35 HNP D + HHR L Sbjct: 418 HNPIDNNKHHRML 430 >SPAC2F3.13c |||queuine tRNA-ribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 235 LRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDS 107 L P+G R VS + +++K+ C P SRG TV PD+ Sbjct: 6 LSSPSGAR--VSSVTVKNKVLKTPCFFLPTSRG-TVPHLTPDN 45 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 154 PPDSRGSTVSISLPDSARLASALEAFRHNP 65 P D + T S S+ L L F+H+P Sbjct: 1010 PEDQKRKTFSFDTSKSSSLLKKLYRFKHDP 1039 >SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 1254 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 118 LPDSARLASALEAFRHNPAD 59 LPD RL S + A R PAD Sbjct: 748 LPDLERLISRVHAGRSKPAD 767 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 23.4 bits (48), Expect = 8.6 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -1 Query: 172 KSHCLEPPDSRG-STVSISLPDSARLASALEAFRHNPADGSSHHRPL 35 K L SRG S+ DS + HNP+ SS H PL Sbjct: 214 KDTSLSRRSSRGRSSAPKRRKDSGSSKTTATYIPHNPSKKSSQHLPL 260 >SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 124 ISLPDSARLASALEAFRHNP 65 ++LP SA+L ++A ++NP Sbjct: 309 VALPQSAKLFQKVKALKNNP 328 >SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces pombe|chr 1|||Manual Length = 355 Score = 23.4 bits (48), Expect = 8.6 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 33 PSGRWCE---LPSAGLCLNASKAEASLAESGKDMLTVE 137 P GR C+ L S GLC +A K ++ + + + + T++ Sbjct: 212 PRGRRCDMCTLSSKGLCPSAFKEKSGITITKRKVKTIK 249 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,352,956 Number of Sequences: 5004 Number of extensions: 24711 Number of successful extensions: 85 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 87815546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -