Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0910
         (744 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9N4M4 Cluster: Nuclear anchorage protein 1; n=4; Rhabd...    33   9.8  

>UniRef50_Q9N4M4 Cluster: Nuclear anchorage protein 1; n=4;
           Rhabditida|Rep: Nuclear anchorage protein 1 -
           Caenorhabditis elegans
          Length = 8545

 Score = 32.7 bits (71), Expect = 9.8
 Identities = 15/69 (21%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = -3

Query: 730 DNFNEVYNAMCSQSIQYSTDTRSYRHHD*NVIYFAMYNGSYPEITQSNCF-IIEMRKTRL 554
           +  NE+Y+       Q  T  R+   HD   I + +  G Y      +C+  +     ++
Sbjct: 763 ERLNEIYDNHSRD--QVDTPNRNLIRHDMGTIIYGLQAGQYANFVDLSCYAFVYDEYNQV 820

Query: 553 PISMTDNII 527
           P+++T+N++
Sbjct: 821 PVNLTENVL 829


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 637,885,731
Number of Sequences: 1657284
Number of extensions: 11866377
Number of successful extensions: 20575
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19826
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20571
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)