Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0910
         (744 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-toler...    22   4.5  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    22   6.0  

>EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-tolerant
           protein.
          Length = 516

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -2

Query: 143 VPVIYLCKHLSFKTITRQIAATYLRSYQ*LRKQGNN 36
           VP++        KT   ++AAT+LR YQ L    N+
Sbjct: 55  VPMVARSAKRMDKTSILRLAATHLRIYQTLLSGKNH 90


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = +1

Query: 232 VWQFFNMFTVS 264
           VW+FFN+F ++
Sbjct: 411 VWKFFNIFLIT 421


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,134
Number of Sequences: 336
Number of extensions: 3713
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19819879
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)