BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0910 (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.3 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 9.2 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 634 YFAMYNGSYPEITQSNCFIIEMRKTRLPISMTDNIIL 524 Y Y G +P T +II RKT + T N+IL Sbjct: 209 YLNTYKGDFPTETDITFYIIIRRKT---LFYTVNLIL 242 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 628 AMYNGSYPEITQSNCFI 578 A+ NG +PE Q C++ Sbjct: 57 AVRNGQWPETRQLKCYM 73 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,020 Number of Sequences: 438 Number of extensions: 3889 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -