BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0876 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132853-3|CAB60438.1| 859|Caenorhabditis elegans Hypothetical ... 30 1.5 Z81062-14|CAB02947.2| 362|Caenorhabditis elegans Hypothetical p... 29 4.7 Z93393-6|CAB07691.2| 495|Caenorhabditis elegans Hypothetical pr... 28 8.2 AL034489-1|CAA22461.1| 538|Caenorhabditis elegans Hypothetical ... 28 8.2 >AL132853-3|CAB60438.1| 859|Caenorhabditis elegans Hypothetical protein Y80D3A.7 protein. Length = 859 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 4/67 (5%) Frame = -3 Query: 419 VKDFDCSVNSITMSPTICKSAFVFSST----VFALVSIWKSDICWFFKPVMFKFLKRITF 252 V++ CS+ T++ + V S+T FA+ S S +C+ ++ V+F + IT Sbjct: 321 VQEAGCSMTVTTVTNLVSFGNGVLSTTPVLQTFAIYSSVASVVCYIYQLVIFPAIIAITA 380 Query: 251 PHRWEQL 231 P+ +++L Sbjct: 381 PNEYQKL 387 >Z81062-14|CAB02947.2| 362|Caenorhabditis elegans Hypothetical protein F15A4.3 protein. Length = 362 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -3 Query: 395 NSITMSPTICKSAFVFSSTVFALVSIWKSDICWFFKPVMFKF 270 N + T +S F+ S VF + +W+ ++ W + V KF Sbjct: 192 NRTPLLQTCLQSIFIGSVAVFGYIMLWRVNLAWRNRIVNLKF 233 >Z93393-6|CAB07691.2| 495|Caenorhabditis elegans Hypothetical protein Y48E1B.5 protein. Length = 495 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 134 SSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSD 247 SS Q L K P DI+PI P++ S+D I D Sbjct: 313 SSIFHQKLSKIFSAEPLPDIYPISPVIDFSMDTIYNDD 350 >AL034489-1|CAA22461.1| 538|Caenorhabditis elegans Hypothetical protein Y7A5A.1 protein. Length = 538 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -3 Query: 311 SDICWFFKPVMFKFLKRITFPHR-WEQLHPMTSQLV 207 +D+CWF+KP +K ++ TF + E+ P+ S L+ Sbjct: 289 NDVCWFYKPWFYKHVE--TFLKKGGEEYIPLESYLL 322 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,073,362 Number of Sequences: 27780 Number of extensions: 360561 Number of successful extensions: 953 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -