BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0868 (798 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53770.1 68414.m06119 expressed protein 30 2.0 At3g53232.1 68416.m05866 expressed protein 28 6.2 >At1g53770.1 68414.m06119 expressed protein Length = 563 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 181 DRRLAAQIEGLYSKSRRSF*ITLVSKNLCFIKFILVYEWLYNE*TCFNYFTLNM 342 ++R +E L S+ RRSF + L K FI +V +Y NYF++ + Sbjct: 45 EQRPTFDVESLRSRLRRSFKLNLTKKQSIFIFLPIVIILIYLSTDFSNYFSVKV 98 >At3g53232.1 68416.m05866 expressed protein Length = 57 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 759 RREKMHVTRRCMEMVVQGRGEEVDRRR 679 +R K ++ RC+ M+V GRG + +R R Sbjct: 28 QRAKFYILGRCLAMLVCGRGRDRERDR 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,611,267 Number of Sequences: 28952 Number of extensions: 326292 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -