BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0827 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_51817| Best HMM Match : Avirulence (HMM E-Value=1.2) 28 7.4 SB_3300| Best HMM Match : Activin_recp (HMM E-Value=0.15) 28 7.4 SB_57978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_42834| Best HMM Match : C2 (HMM E-Value=3.7e-20) 27 9.8 SB_17294| Best HMM Match : Avirulence (HMM E-Value=1.8) 27 9.8 >SB_19903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 36 NSSGKQPGYQVRGEHTVNCLTG 101 N + K PGY+++G+H N LTG Sbjct: 361 NLTRKYPGYELKGQHPENELTG 382 >SB_51817| Best HMM Match : Avirulence (HMM E-Value=1.2) Length = 643 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = -2 Query: 247 RQSCFYRHYRLKQASHSIISNHHRPRTSTMPRAP*SRFLP*RADTRHFSPVKQFTVCSPR 68 RQ YRHY + A + I+ T+P S + D+ H + + Q TV + + Sbjct: 460 RQCSLYRHYPIDSAHCTDITQQTVRTVQTLPNRQWSLYRHYPTDSAHCADITQQTVRTVQ 519 Query: 67 T 65 T Sbjct: 520 T 520 >SB_3300| Best HMM Match : Activin_recp (HMM E-Value=0.15) Length = 281 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 68 TGGAYGELFDGTEVPSICSLW*EAASRRPWHC 163 TG +G++FD VP+ SLW + P C Sbjct: 16 TGCCHGDMFDNGTVPARDSLWPTGSRDEPASC 47 >SB_57978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 263 YAILRTSELFLSPL*TEAGVSLDNKQSPSPTDINNAKGAVKPLPTI 126 Y + TS + PL + G S +PSP + + P+PTI Sbjct: 36 YKLFSTSSMCDPPLPSPMGGSPKKSPAPSPRSSHGLSPRMSPIPTI 81 >SB_42834| Best HMM Match : C2 (HMM E-Value=3.7e-20) Length = 808 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 263 YAILRTSELFLSPL*TEAGVSLDNKQSPSPTDINNAKGAVKPLPTI 126 Y + TS + PL + G S +PSP + + P+PTI Sbjct: 671 YKLFSTSSMCDPPLPSPMGGSPKKSPAPSPRSSHGLSPRMSPIPTI 716 >SB_17294| Best HMM Match : Avirulence (HMM E-Value=1.8) Length = 771 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/61 (27%), Positives = 26/61 (42%) Frame = -2 Query: 247 RQSCFYRHYRLKQASHSIISNHHRPRTSTMPRAP*SRFLP*RADTRHFSPVKQFTVCSPR 68 RQ YRHY A + I+ T+P S + D+ H + + Q TV + + Sbjct: 269 RQCALYRHYPTDSAHCTDIAQQTVVTVQTLPNRQCSLYRHYPTDSAHCADITQQTVFTVQ 328 Query: 67 T 65 T Sbjct: 329 T 329 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = -2 Query: 247 RQSCFYRHYRLKQASHSIISNHHRPRTSTMPRAP*SRFLP*RADTRHFSPVKQFTVCSPR 68 RQ YRHY + A + I+ T+P S + D+ H + + Q TV + + Sbjct: 397 RQCSLYRHYPIDSAHCTDITQQTVRTVQTLPNRQWSLYRHYPTDSGHCTDITQQTVRTVQ 456 Query: 67 T 65 T Sbjct: 457 T 457 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,283,440 Number of Sequences: 59808 Number of extensions: 378414 Number of successful extensions: 805 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -