BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0827 (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16270.1 68414.m01948 protein kinase family protein contains ... 29 2.0 >At1g16270.1 68414.m01948 protein kinase family protein contains PF|00069 Eukaryotic protein kinase domain. ESTs gb|H37741, gb|T43005 and gb|AI100340 come from this gene Length = 1147 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -2 Query: 226 HYRLKQASHSIISNHHRPRTSTMPRAP*SRFLP*RADTRHFSPVKQFT 83 H QA + + N +T+P + LP R DTR +PVK T Sbjct: 492 HQNPPQADDTEVKNREPSVATTVPSQDAAHMLPPRRDTRQNTPVKPST 539 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,337,156 Number of Sequences: 28952 Number of extensions: 258266 Number of successful extensions: 626 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -