SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0824
         (696 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1017 - 23318187-23318348,23318747-23318857,23319859-233199...    30   2.0  

>07_03_1017 -
           23318187-23318348,23318747-23318857,23319859-23319964,
           23320113-23320153
          Length = 139

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = -2

Query: 356 QLGMKKRVLKNSTVVNKVNSHHFSNVISFELFTFFILY 243
           Q G+K  + + +  + +  S+H  +V+ F LF FF++Y
Sbjct: 94  QAGVKHNMRRMNKSIIQQGSNHVVHVVLFALFCFFVVY 131


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,649,658
Number of Sequences: 37544
Number of extensions: 280433
Number of successful extensions: 476
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 462
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 476
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1780264028
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -