BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0823 (452 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 0.89 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 6.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 6.3 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 0.89 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +1 Query: 19 NLSFYKLQTQSLRHET*DISVFVNNFSGGFSAAVPRLGVEPGE 147 N + Y + S+RH ++S N+ G P + +PG+ Sbjct: 628 NENIYSGKLISMRHLKEEVSSIETNYECGLRFEDPMISFQPGD 670 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 128 RRGTAAENPPLKLLTNTLISY 66 +RGT PP K T ++ Y Sbjct: 897 QRGTVVSPPPTKRRTMKVVKY 917 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 128 RRGTAAENPPLKLLTNTLISY 66 +RGT PP K T ++ Y Sbjct: 935 QRGTVVSPPPTKRRTMKVVKY 955 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,121 Number of Sequences: 438 Number of extensions: 1955 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -