BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0770 (373 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 3.7 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 8.5 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 3.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 206 SISSILNST*DILSKLQFPILRHIYKKWNVTER 108 S++ L S D L K+Q P ++ + K VTE+ Sbjct: 1005 SLAKELQSKLDTLEKIQTPNMKAMQKLDRVTEK 1037 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 21.8 bits (44), Expect = 8.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 197 SILNST*DILSKLQFPILRHIYKKWNV 117 S+LN+ +LSK+ P L I KW + Sbjct: 523 SLLNTDYKLLSKVIKPRLDCIIGKWGI 549 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,504 Number of Sequences: 2352 Number of extensions: 5567 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28374390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -