BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0770 (373 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 26 0.12 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 26 0.12 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 26 0.12 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 26 0.12 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 26 0.12 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.29 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.29 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.29 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.29 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 25 0.38 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 25 0.38 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 25 0.38 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 25 0.38 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 0.38 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 25 0.38 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 25 0.38 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 25 0.38 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 25 0.38 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 24 0.50 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 24 0.50 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 0.50 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 0.50 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 24 0.66 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 24 0.66 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 0.66 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 0.66 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 0.88 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 0.88 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 0.88 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 0.88 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 1.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 1.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 1.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 1.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 1.2 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 1.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 1.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 2.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 2.0 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 2.0 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 2.0 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 2.0 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 2.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 2.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 2.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 2.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 2.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 2.0 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 3.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 3.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 3.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 3.5 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 4.7 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 4.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 4.7 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 26.2 bits (55), Expect = 0.12 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 237 STQPLKQATNEYKLNSKFYLRYIEQAPVP 151 S + + N YK + + YIEQ PVP Sbjct: 86 SNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 26.2 bits (55), Expect = 0.12 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 237 STQPLKQATNEYKLNSKFYLRYIEQAPVP 151 S + + N YK + + YIEQ PVP Sbjct: 86 SNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 26.2 bits (55), Expect = 0.12 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 237 STQPLKQATNEYKLNSKFYLRYIEQAPVP 151 S + + N YK + + YIEQ PVP Sbjct: 86 SNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 26.2 bits (55), Expect = 0.12 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 237 STQPLKQATNEYKLNSKFYLRYIEQAPVP 151 S + + N YK + + YIEQ PVP Sbjct: 86 SNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 26.2 bits (55), Expect = 0.12 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 237 STQPLKQATNEYKLNSKFYLRYIEQAPVP 151 S + + N YK + + YIEQ PVP Sbjct: 319 SNKTIHNNNNNYKKLQYYNINYIEQIPVP 347 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.29 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ PVP Sbjct: 316 NNYKKLQYYNINYIEQIPVP 335 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.29 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ PVP Sbjct: 327 NNYKKLQYYNINYIEQIPVP 346 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.29 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ PVP Sbjct: 327 NNYKKLQYYNINYIEQIPVP 346 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.29 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ PVP Sbjct: 316 NNYKKLQYYNINYIEQIPVP 335 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 0.38 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ P+P Sbjct: 105 NNYKKLQYYNINYIEQIPIP 124 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 0.38 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ P+P Sbjct: 105 NNYKKLQYYNINYIEQIPIP 124 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 0.38 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ P+P Sbjct: 105 NNYKKLQYYNINYIEQIPIP 124 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 0.38 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ P+P Sbjct: 105 NNYKKLQYYNINYIEQIPIP 124 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.38 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFY--LRYIEQAPVP 151 N + N+ N K Y + YIEQ PVP Sbjct: 88 NYISNISNYNNDNNYNKKLYYNINYIEQIPVP 119 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.38 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -2 Query: 258 SHFQVANSTQPLKQATNEYKLNSKFYLRYIEQAPVPDTASY 136 S+ + N+ N Y + + YIEQ P+P Y Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.38 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -2 Query: 258 SHFQVANSTQPLKQATNEYKLNSKFYLRYIEQAPVPDTASY 136 S+ + N+ N Y + + YIEQ P+P Y Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.38 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -2 Query: 258 SHFQVANSTQPLKQATNEYKLNSKFYLRYIEQAPVPDTASY 136 S+ + N+ N Y + + YIEQ P+P Y Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.38 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -2 Query: 258 SHFQVANSTQPLKQATNEYKLNSKFYLRYIEQAPVPDTASY 136 S+ + N+ N Y + + YIEQ P+P Y Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 102 NKHNYNKLYYNINYIEQIPIP 122 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 335 NKHNYNKLYYNINYIEQIPIP 355 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -2 Query: 210 NEYKLNSKFY-LRYIEQAPVP 151 N++ N +Y + YIEQ P+P Sbjct: 335 NKHNYNKLYYNINYIEQIPIP 355 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 0.66 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK K Y+ IEQ PVP Y Sbjct: 111 NNYKKLYKNYIINIEQIPVPVPVYY 135 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 0.66 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK K Y+ IEQ PVP Y Sbjct: 111 NNYKKLYKNYIINIEQIPVPVPVYY 135 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 0.66 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFY--LRYIEQAPVP 151 N + N N K Y + YIEQ PVP Sbjct: 88 NYISNISNYNNNNNYNKKLYYNINYIEQIPVP 119 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 0.66 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFY--LRYIEQAPVP 151 N + N N K Y + YIEQ PVP Sbjct: 326 NYISNISNYNNNNNYNKKLYYNINYIEQIPVP 357 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.4 bits (48), Expect = 0.88 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N Y + + YIEQ PVP Sbjct: 102 NNYNKKLYYNINYIEQIPVP 121 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.88 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 99 NNYNNYKKLYYNINYIEQVPVP 120 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.4 bits (48), Expect = 0.88 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 246 VANSTQPLKQATNEYKLNSKFY-LRYIEQAPVP 151 ++N T N Y +Y + YIEQ PVP Sbjct: 307 LSNKTIHNNNNYNNYNNKKLYYNINYIEQIPVP 339 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 0.88 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -2 Query: 264 YCSHFQVANSTQPLKQATNEYKLNSK---FYLRYIEQAPVP 151 Y ++ N+ N Y N K + + YIEQ PVP Sbjct: 324 YSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNINYIEQIPVP 364 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 101 NNYNNYKKLYYNINYIEQIPVP 122 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.0 bits (47), Expect = 1.2 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSK---FYLRYIEQAPVP 151 N+ N Y N K + + YIEQ PVP Sbjct: 93 NNNYKYNYNNNNYNNNCKKLYYNINYIEQIPVP 125 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 1.2 Identities = 12/38 (31%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSK---FYLRYIEQAPVPDTASY 136 N+ N Y N K + + YIEQ P+P Y Sbjct: 93 NNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPVYY 130 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 1.2 Identities = 12/38 (31%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSK---FYLRYIEQAPVPDTASY 136 N+ N Y N K + + YIEQ P+P Y Sbjct: 93 NNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPVYY 130 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 1.2 Identities = 12/38 (31%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSK---FYLRYIEQAPVPDTASY 136 N+ N Y N K + + YIEQ P+P Y Sbjct: 93 NNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPVYY 130 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ PVP Sbjct: 109 NNYNNYKKLYYNINYIEQIPVP 130 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/22 (45%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -2 Query: 210 NEYKLNSKFY--LRYIEQAPVP 151 N Y K Y + YIEQ P+P Sbjct: 101 NNYNNYKKLYYNINYIEQIPIP 122 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFYLRYIEQAPVP 151 N+ K N YK + + YIEQ P+P Sbjct: 92 NNNNYKKLYCNNYK-KLYYNINYIEQIPIP 120 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFYLRYIEQAPVP 151 N+ K N YK + + YIEQ P+P Sbjct: 92 NNNNYKKLYCNNYK-KLYYNINYIEQIPIP 120 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 92 NNYNNNYKPLYYNINYIEQIPVP 114 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 92 NNYNNNYKPLYYNINYIEQIPVP 114 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 92 NNYNNNYKPLYYNINYIEQIPVP 114 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 92 NNYNNNYKPLYYNINYIEQIPVP 114 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 325 NNYNNNYKPLYYNINYIEQIPVP 347 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 325 NNYNNNYKPLHYNINYIEQIPVP 347 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 325 NNYNNNYKPLYYNINYIEQIPVP 347 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 325 NNYNNNYKPLYYNINYIEQIPVP 347 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 210 NEYKLNSK---FYLRYIEQAPVP 151 N Y N K + + YIEQ PVP Sbjct: 314 NNYNNNYKPLYYNINYIEQIPVP 336 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 2.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK + + YIEQ PVP Y Sbjct: 97 NNYK-QLCYNINYIEQIPVPVPVYY 120 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 2.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK + + YIEQ PVP Y Sbjct: 97 NNYK-QLCYNINYIEQIPVPVPVYY 120 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 2.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK + + YIEQ PVP Y Sbjct: 97 NNYK-QLCYNINYIEQIPVPVPVYY 120 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 2.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK + + YIEQ PVP Y Sbjct: 97 NNYK-QLCYNINYIEQIPVPVPVYY 120 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 2.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVPDTASY 136 N YK + + YIEQ PVP Y Sbjct: 97 NNYK-QLCYNINYIEQIPVPVPVYY 120 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 201 KLNSKFYLRYIEQAPVPDTASY 136 KL K Y+ IEQ PVP Y Sbjct: 114 KLYYKNYIINIEQIPVPVPVYY 135 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 3.5 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 7/32 (21%) Frame = -2 Query: 210 NEYKLN-----SKFY--LRYIEQAPVPDTASY 136 N YK N K Y + YIEQ P+P Y Sbjct: 94 NNYKYNYNNNCKKLYYNINYIEQIPIPVPVYY 125 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 3.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 210 NEYKLNSKFYLRYIEQAPVP 151 N YK + + YIEQ P+P Sbjct: 321 NNYK-KLYYNINYIEQIPIP 339 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 201 KLNSKFYLRYIEQAPVPDTASY 136 KL K Y+ IEQ PVP Y Sbjct: 339 KLYYKNYIINIEQIPVPVPVYY 360 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 4.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 240 NSTQPLKQATNEYKLNSKFYLRYIEQAPVP 151 N+ K N Y+ + + YIEQ P+P Sbjct: 92 NNNNYKKLYCNNYR-KLYYNINYIEQIPIP 120 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.0 bits (42), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 201 KLNSKFYLRYIEQAPVP 151 KL K Y+ IEQ PVP Sbjct: 103 KLYYKNYIINIEQIPVP 119 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 201 KLNSKFYLRYIEQAPVP 151 KL K Y+ IEQ PVP Sbjct: 344 KLYYKNYIINIEQIPVP 360 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,003 Number of Sequences: 438 Number of extensions: 1869 Number of successful extensions: 82 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -