BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0758 (777 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.012 SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 37 0.016 SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_28521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_40834| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 31 1.4 SB_34332| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 29 4.2 SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_5204| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.014) 29 5.5 SB_20062| Best HMM Match : Tsg101 (HMM E-Value=0.41) 28 7.3 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 28 7.3 SB_41164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 28 9.7 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_55408| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.4) 28 9.7 SB_53664| Best HMM Match : PARP_reg (HMM E-Value=0) 28 9.7 SB_21087| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.4) 28 9.7 >SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/29 (62%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++L +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSLDHSKTRTHVRLLGPCFKTG 45 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F + ++ +S TRTH RLLGPC+KTG Sbjct: 247 AFTFISPRSFDHSKTRTHVRLLGPCFKTG 275 >SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 141 AFTFITPRSFGHSKTRTHVRLLGPCFKTG 169 >SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 260 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 288 >SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 637 AFQF-NVKNL*NSMTRTHARLLGPCYKTG 554 AF F ++ +S TRTH RLLGPC+KTG Sbjct: 17 AFTFITPRSFDHSKTRTHVRLLGPCFKTG 45 >SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 607 NSMTRTHARLLGPCYKTG 554 +S TRTH RLLGPC+KTG Sbjct: 28 HSKTRTHVRLLGPCFKTG 45 >SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 1 GKVEKNFEERVQEYVKPFRGKPAKLE*TNGEIH 99 GK EK+FE+RV++YVK +GK L IH Sbjct: 23 GKDEKHFEKRVKKYVKTLKGKRMGLAMRRARIH 55 >SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 607 NSMTRTHARLLGPCYKT 557 +S TRTH RLLGPC+KT Sbjct: 352 HSETRTHVRLLGPCFKT 368 >SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +1 Query: 1 GKVEKNFEERVQEYVKPFRGKP 66 GK++ ++RV++YVKP +GKP Sbjct: 23 GKMKSTLKKRVKKYVKPLKGKP 44 >SB_28521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +3 Query: 543 ALAGPVL*HGPRSLACVRVIE 605 A + P L HGPRSL CVRV E Sbjct: 61 ASSDPCLKHGPRSLTCVRVFE 81 >SB_40834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1299 Score = 31.5 bits (68), Expect = 0.79 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R RQ RKR +RKR Sbjct: 1076 RQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKR 1132 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R RQ RKR +RKR Sbjct: 1034 RKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKR 1090 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1118 RQRRRKRKRRRKRKRRRKRQRRRKRKRRRKRQRRRKRQRRRKRKRRRKRKRRRKRKR 1174 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1136 RQRRRKRKRRRKRQRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1192 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1154 RQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1210 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1040 RKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRKR 1096 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1046 RKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKR 1102 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1058 RKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1114 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1148 RQRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1204 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1160 RKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1216 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1166 RKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1222 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R +R R +R +R RQ RKR +RKR Sbjct: 1112 RKRRRKRQRRRKRKRRRKRKRRRKRQRRRKRKRRRKRQRRRKRQRRRKRKRRRKRKR 1168 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R KR R +R +R R+ RKR +RKR Sbjct: 1142 RKRRRKRQRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1198 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R +R R +R +R R+ RKR +RKR Sbjct: 1052 RKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKR 1108 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 R R + R+ R R K R +R R +R +R R+ RKR +RKR Sbjct: 1124 RKRRRKRKRRRKRQRRRKRKRRRKRQRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKR 1180 >SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +1 Query: 1 GKVEKNFEERVQEYVKPFRGK 63 GK++ E+RV++YVKP +GK Sbjct: 23 GKMKSTLEKRVKKYVKPLKGK 43 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = -2 Query: 275 LPRDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPER 105 + RDR + RR RD K + SRD ++SR+ + R++ R+ + ++R+ ER Sbjct: 293 IERDRHRDRRHSRDR--DRKRSRSRDRRKSRSRSRDRRRSRSRERRRDDRKRRSRER 347 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = -2 Query: 269 RDRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERK 102 RDR + R RD R+ + SRD +RSR+ + KR R+ + ++R+ ER+ Sbjct: 305 RDRDRKRSRSRDR--RKSRSRSRDRRRSRSRERRRDDRKRRSRER-SPKRRSRERE 357 >SB_34332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +2 Query: 554 TRLVTRTKESSMCAS 598 TRL TRTKES+MCAS Sbjct: 35 TRLETRTKESNMCAS 49 >SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +1 Query: 7 VEKNFEERVQEYVKPFRGK 63 ++ +FE+RV++YVKP +GK Sbjct: 1 MKSHFEKRVKKYVKPLKGK 19 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -2 Query: 266 DRLKPRRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 DR + GR R S +SRT P R++ ++H ++ RTP R R Sbjct: 42 DRKRGHSRGRRDDRRGGKRRSFSRSKSRTPPRHRRRSRSPNKKHSRSKSRTPPRHR 97 >SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 1 GKVEKNFEERVQEYVKPFRGK 63 GK++ ++RV++YVKP +GK Sbjct: 23 GKMKSTLKKRVKKYVKPLKGK 43 >SB_5204| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.014) Length = 351 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -2 Query: 224 REKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPER 105 R +C +R +KR R + T + T + FR+ L+ ++ ER Sbjct: 11 RLRCKITRAIKRIRNLTTTDTTTAKRFRKELDQLRKDFER 50 >SB_20062| Best HMM Match : Tsg101 (HMM E-Value=0.41) Length = 686 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 508 RTSPRLHGCDNRRVALASALRQETRKYDVDLRR 410 + SP + R LA LRQ T Y+ +LRR Sbjct: 482 KVSPEMEALVRERNDLARELRQRTEAYEAELRR 514 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -3 Query: 673 ERTSSVRLHFRYAFQFNVKNL*NSMTRTHARLLGPCYK 560 +R+S +RLH R +KN +++TR +LL P +K Sbjct: 235 QRSSDLRLHSRKQPDIPIKNQLSNITRLLEQLLNPDHK 272 >SB_41164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = -2 Query: 239 RDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR*ISPFVHSSF 69 + L++ K S V ++ +P R R+HL A ERK I P V F Sbjct: 42 KKGLVKTKRLRSASVGEAQNMPKTTAGQLRPSRRHLKAPSTGKERKAYILPTVQEEF 98 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -2 Query: 224 REKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 99 + K S RD RSR + ++ R +++ +R R+ ER+R Sbjct: 291 KHKRKSKRDRSRSRDRSSSKSKSLRRSKKYSRSRSRSSERRR 332 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 27.9 bits (59), Expect = 9.7 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = -2 Query: 302 VLNE*NSYGLPRDRLKPRRTGRDAL--LREKCTSSRDVKRSRTVPTENERTKRTFRQHLN 129 +++E +++ L + LK D L L+ K SRD RSR ER +R+ + Sbjct: 326 IIHELDNFELDSEGLKEILDKLDGLGRLKRKADRSRDRSRSRESQRSRERVERSQSRSCE 385 Query: 128 ARK--RTPERKR 99 K R ER+R Sbjct: 386 YHKARRAKERER 397 >SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 19 FEERVQEYVKPFRGK 63 FE+RV++YVKP +GK Sbjct: 5 FEKRVKKYVKPLKGK 19 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = -2 Query: 227 LREKCTSSRDVK---RSRTVPTENERTKRT 147 +R K T S+ VK RSR +PTE E+T R+ Sbjct: 421 IRAKETGSQKVKSKIRSRDLPTEKEKTSRS 450 >SB_55408| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.4) Length = 118 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 251 RRTGRDALLREKCTSSRDVKRSRTVPTENERT 156 R D +LREK S D+ RT+P N + Sbjct: 34 RERNSDVILREKRRGSEDLMTGRTIPFANRNS 65 >SB_53664| Best HMM Match : PARP_reg (HMM E-Value=0) Length = 834 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 11 KRTLKREFKST*NRSGVNLRNSNERTERFIVFSRAYVYVRSDVDGTFVSCVRSPSARY 184 +R ++ S NR V+ + E E I+ + Y YV S+ D PSA + Sbjct: 724 RRRKRKNLMSRENRLDVSAIINEEEREVLIILCQCYAYVASNPDRRLGKTAPDPSATH 781 >SB_21087| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.4) Length = 118 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 251 RRTGRDALLREKCTSSRDVKRSRTVPTENERT 156 R D +LREK S D+ RT+P N + Sbjct: 34 RERNSDVILREKRRGSEDLMTGRTIPFANRNS 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,384,685 Number of Sequences: 59808 Number of extensions: 427843 Number of successful extensions: 1505 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1494 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -