BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0706 (407 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0105 - 22812730-22813066,22813406-22813565,22814613-22814820 34 0.050 08_01_0296 + 2383578-2384220,2384754-2384829,2384942-2385057,238... 27 7.6 >04_04_0105 - 22812730-22813066,22813406-22813565,22814613-22814820 Length = 234 Score = 33.9 bits (74), Expect = 0.050 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +3 Query: 243 PLYRIVDVDIGDWEKTRKVVXS----LGHFDALVNNAAVAVCEPFLDCSPINFDKTFD 404 P Y ++++D+ E R V LG D LVNNA V + P + F + FD Sbjct: 8 PRYLLLELDVRSDESARAAVADAVRELGRVDVLVNNAGVHLVAPLAEVPMEEFQQVFD 65 >08_01_0296 + 2383578-2384220,2384754-2384829,2384942-2385057, 2385957-2386522 Length = 466 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 302 NNLPRLLPISYINVYNSIEGY 240 +NLPR L + Y+N +S EGY Sbjct: 298 DNLPRTLLMYYVNFISSPEGY 318 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,770,799 Number of Sequences: 37544 Number of extensions: 140680 Number of successful extensions: 290 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -