BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0706 (407 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 25 0.33 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 4.1 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 25.0 bits (52), Expect = 0.33 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 297 VVXSLGHFDALVNNAAVAVCEPFLDCSPINFDKTFDV 407 V +LG D L+NNA + + + +++ K FD+ Sbjct: 78 VEKNLGAIDILINNATINIDVTLQNDEVLDWKKIFDI 114 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 4.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 211 EFVTMQLYLHLHATIQSQFLCRYLARH 131 E V +++ L A++ +QF Y++RH Sbjct: 243 EHVAVKMRQDLGASLDTQFKKIYMSRH 269 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,166 Number of Sequences: 438 Number of extensions: 1694 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -