BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0701 (677 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0456 + 3522599-3523921,3524005-3524027,3524097-3525265,352... 29 3.4 04_04_0903 - 29269794-29270141,29270227-29270751 28 6.0 >11_01_0456 + 3522599-3523921,3524005-3524027,3524097-3525265, 3525373-3525737 Length = 959 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +1 Query: 487 RLNNRLTILRACSRVS---NYWKLYTCKFQLYSSTHKIYFRLADDFNL 621 R N L IL ACS + N +K +F HK + DD NL Sbjct: 701 RHRNLLPILTACSSIDSEGNDFKALVYEFMSQGDLHKFLYTTRDDINL 748 >04_04_0903 - 29269794-29270141,29270227-29270751 Length = 290 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 81 HGRNRRDGITYPCGL 125 HGR+RR G+TYP L Sbjct: 54 HGRHRRTGVTYPVSL 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,471,256 Number of Sequences: 37544 Number of extensions: 321618 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -