BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0701 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54931| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_33187| Best HMM Match : rve (HMM E-Value=1.1) 29 4.6 SB_12549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_47104| Best HMM Match : Lambda_Kil (HMM E-Value=4.4) 28 8.0 >SB_54931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 280 RTSCPLGHDDFQNCFCPYTPFYGTYTLNN 366 R PL DD Q C Y PF TL N Sbjct: 145 RQGWPLAKDDLQVCLMDYFPFRDELTLQN 173 >SB_33187| Best HMM Match : rve (HMM E-Value=1.1) Length = 268 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 280 RTSCPLGHDDFQNCFCPYTPFYGTYTLNN 366 R PL DD Q C Y PF TL N Sbjct: 145 RQGWPLAKDDLQVCLMDYFPFRDELTLQN 173 >SB_12549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 Query: 331 RDKNNFGSRRGLKDKMSGAFVSSDAPCSIP 242 R K +FGS + + M+G+F+SSD P P Sbjct: 184 RAKGSFGSSKDYELYMTGSFLSSDNPNENP 213 >SB_47104| Best HMM Match : Lambda_Kil (HMM E-Value=4.4) Length = 224 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 280 RTSCPLGHDDFQNCFCPYTPFYGTYTLNN 366 R PL DD Q C Y PF TL N Sbjct: 33 RQGWPLAKDDLQVCLRDYFPFRDELTLQN 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,675,134 Number of Sequences: 59808 Number of extensions: 403669 Number of successful extensions: 3931 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3931 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -