BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0701 (677 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical pr... 30 1.3 AL132847-4|CAB63373.3| 965|Caenorhabditis elegans Hypothetical ... 27 9.3 >Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical protein F15D4.1 protein. Length = 1529 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 111 YPCGLTRDPNTSFIFIT-RCYSFTVDVNREHLLSMYFIRKIDTLCGIEHGASLDTNAPDI 287 Y C LT D + F+ RC S DV L+++ +RK+ + H AP Sbjct: 1215 YECELTEDQKEIYRFVVDRCTSSQEDVGLSSLVTLITLRKLTDHTKLVHDTLAKIGAPQY 1274 Query: 288 L 290 + Sbjct: 1275 I 1275 >Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical protein F15D4.1 protein. Length = 1529 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 111 YPCGLTRDPNTSFIFIT-RCYSFTVDVNREHLLSMYFIRKIDTLCGIEHGASLDTNAPDI 287 Y C LT D + F+ RC S DV L+++ +RK+ + H AP Sbjct: 1215 YECELTEDQKEIYRFVVDRCTSSQEDVGLSSLVTLITLRKLTDHTKLVHDTLAKIGAPQY 1274 Query: 288 L 290 + Sbjct: 1275 I 1275 >AL132847-4|CAB63373.3| 965|Caenorhabditis elegans Hypothetical protein Y48G10A.4 protein. Length = 965 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +3 Query: 180 VDVNREHLLSMYFIRKIDTLCGIEHGASLDTNAPDILSFRP--RRLPKLFLSLHPILRYL 353 +++ +H SM + +DTL + S + N P +L+ + RR K +L I L Sbjct: 904 IELLSQHYHSMMMTKSLDTLYTGANSLSANKNVPQVLATQEINRRTTKFLTALSSIYFGL 963 Query: 354 H 356 H Sbjct: 964 H 964 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,772,135 Number of Sequences: 27780 Number of extensions: 305928 Number of successful extensions: 604 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -