BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0587 (522 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 2.9 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 3.8 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 3.8 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 21 5.0 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 8.7 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 56 TNPSNERTSTAMVLTSTLNSS 118 T+PSN TST+ ++ NSS Sbjct: 424 TSPSNTNTSTSSTNSNKPNSS 444 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 218 LQVDVLIF-KYWLYLVLWA 165 LQV + F YWLYLVL A Sbjct: 49 LQVLFVSFVSYWLYLVLEA 67 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 218 LQVDVLIF-KYWLYLVLWA 165 LQV + F YWLYLVL A Sbjct: 67 LQVLFVSFVSYWLYLVLEA 85 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 21.4 bits (43), Expect = 5.0 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 249 RQSADSTREQWFFQPAKY 302 ++ + S R +WFFQ ++ Sbjct: 78 QEGSKSGRNKWFFQKGRF 95 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 222 QRSGPCCIRRQSADSTREQWFFQPAKYEND 311 Q+ G I R D+ + W AKY+ D Sbjct: 84 QKEGSDFIMRYLIDNKPDYWKALEAKYDPD 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,735 Number of Sequences: 336 Number of extensions: 2073 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -