BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0584 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54977| Best HMM Match : MFS_1 (HMM E-Value=0.006) 31 0.93 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 30 1.6 SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 30 1.6 SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 30 1.6 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 30 1.6 SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 30 1.6 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 30 1.6 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 30 1.6 SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) 29 2.9 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) 29 3.8 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) 28 6.6 SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 28 6.6 SB_24764| Best HMM Match : DUF212 (HMM E-Value=9.4) 27 8.7 SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) 27 8.7 SB_57058| Best HMM Match : ROKNT (HMM E-Value=8) 27 8.7 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 8.7 SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 27 8.7 SB_30231| Best HMM Match : POPLD (HMM E-Value=2.5) 27 8.7 SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) 27 8.7 SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) 27 8.7 SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) 27 8.7 >SB_54977| Best HMM Match : MFS_1 (HMM E-Value=0.006) Length = 698 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 554 YT*SFYIFFGYYGCKIISLFKFNF 483 YT FY F + C +I+ FKFNF Sbjct: 196 YTPCFYSFAAFLSCALITSFKFNF 219 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 219 SWLRLFKLDWPSMKLVEGKNTALSDLTE 246 >SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 425 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 377 SWLRLFKLDWPSIKLVQGKNTALSDLTE 404 >SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R N D+F+++ GE + I Sbjct: 155 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLDDVFVFYPGEGYRNMHVI 211 Query: 449 PSYDTQSNVVPKN 487 P YDT ++ P + Sbjct: 212 PGYDTAADEYPSH 224 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 293 SWLRLFKLDWPSIKLVQGKNTALSDLTE 320 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 797 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 287 SWLRLFKLDWPSIKLVQGKNTALSDLTE 314 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 164 SWLRLFKLDWPSIKLVQGKNTALSDLTE 191 >SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 15 SWLRLFKLDWPSIKLVQGKNTALSDLTE 42 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 399 SWLRLFKLDWPSIKLVQGKNTALSDLTE 426 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 467 SWLRLFKLDWPSIKLVQGKNTALSDLTE 494 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 1117 SWLRLFKLDWPSIKLVQGKNTALSDLTE 1144 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 143 SWLRLFKLDWPSMKLVEGKNTALSDLTE 170 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 176 SWLRLFKLDWPSIKLVQGKNTALSDLTE 203 >SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KGK P++ + + F L R L N D+F+++ GE + I Sbjct: 203 PFTQKGK---PYKKAAFERLCIEFGLPRKPDFRLKGGRNHGLGDVFVFYPGEGYRNVHVI 259 Query: 449 PSYDTQSNVVPKN 487 YDT + P + Sbjct: 260 RGYDTAMDEYPSH 272 >SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) Length = 419 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL G+N + + E Sbjct: 349 SWLRLFKLDWPSIKLVQGKNIALSDLTE 376 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = -1 Query: 367 CINNGAIQREAKRLIVKNKRFERSQVLAFVVEWIDENKSWNGN 239 C+N R + ++K++ + ++ A++VE I+ +K W N Sbjct: 1042 CLNKDPNDRPTAKELLKHRFIKTAKKNAYLVELIERHKKWKQN 1084 >SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) Length = 253 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = -1 Query: 367 CINNGAIQREAKRLIVKNKRFERSQVLAFVVEWIDENKSWNGN 239 C+N R + ++K++ + ++ A++VE I+ +K W N Sbjct: 108 CLNKDPNDRPTAKELLKHRFIKTAKKNAYLVELIERHKKWKQN 150 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+L+W + KL G+N + + E Sbjct: 344 SWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+L+W + KL G+N + + E Sbjct: 827 SWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R N D+F+++ GER+ I Sbjct: 186 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGERYRNVHVI 242 Query: 449 PSYDTQSNVVPKN 487 YDT ++ P + Sbjct: 243 RGYDTAADEYPSH 255 >SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 348 IAPLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHS 467 I PL+ L C+S + T ++GSL++ + ++TH+ Sbjct: 45 ILPLVPRPKELLECVSNMRLLTWLLHGSLSHMVHSKITHA 84 >SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R V N D+F+++ GE + I Sbjct: 177 PFTQKGN---PYKKAAFERLCIEFGLPRKQVFRWKGGRNHGLGDVFVFYPGEGYCNVHVI 233 Query: 449 PSYDTQSNVVPKN 487 YDT ++ P + Sbjct: 234 RGYDTAADEYPSH 246 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R + N D+F+++ GE + I Sbjct: 179 PFTQKGN---PYKKAAFERLCIEFGLPRKLDFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 235 Query: 449 PSYDTQSNVVPKN 487 SYDT ++ P + Sbjct: 236 CSYDTAADEYPSH 248 >SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) Length = 842 Score = 27.9 bits (59), Expect = 6.6 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 269 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 439 PF KG A FE ++ P G P++R N D+F+++ GER Sbjct: 132 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERR--------RNHGLGDVFVFYPGERCRNV 183 Query: 440 FNIPSYDTQSNVVPKN 487 I YDT ++ P + Sbjct: 184 HVIRGYDTAADKYPSH 199 >SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 398 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 487 D+F+++ GE + IP YDT ++ P + Sbjct: 259 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 288 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.9 bits (59), Expect = 6.6 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 269 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 439 PF KG A FE ++ P G P++R L D+F+++ GE + Sbjct: 128 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERRAEHGL--------GDVFVFYPGEGYRNV 179 Query: 440 FNIPSYDTQSNVVPKN 487 I YDT ++ P + Sbjct: 180 HVIRGYDTAADEYPSH 195 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 398 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 487 D+F+++ GE + IP YDT ++ P + Sbjct: 253 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 282 >SB_24764| Best HMM Match : DUF212 (HMM E-Value=9.4) Length = 148 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 10 RTTGLNSSSWTGSQLNSPLVRTRLSAIR 93 +TTG+ SS WT LN + T +S ++ Sbjct: 72 KTTGIPSSHWTAGALNYARIFTSMSGLQ 99 >SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) Length = 762 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 111 KEDSVPMTEIMKMLDEGKVPFDMSEEFCYMPKRLMLPRGTEGG 239 K++ TE LDE K D+ E Y K+ +P+GT+ G Sbjct: 592 KKEVSAATESKDALDETKKCKDLPVENAYENKKNYVPQGTQAG 634 >SB_57058| Best HMM Match : ROKNT (HMM E-Value=8) Length = 200 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +3 Query: 45 FTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDEGKVP 170 + K TA +K ++NE +E+ +P+ + + D+ VP Sbjct: 142 YNDKSTAHNDKRTTDNNESTAVREEKIPLPCVASLFDQTAVP 183 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 317 EQKIRKEPSPCLCCRMDRRKQELEWESTFSTSRQ 216 E++ R P+ C CCR D EL+ E+ F+ ++ Sbjct: 169 EKRKRTHPAKCPCCRSD---SELQQENGFAVCKE 199 >SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1084 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL +N + + E Sbjct: 365 SWLRLFKLDWPSIKLVQSKNTALSDLTE 392 >SB_30231| Best HMM Match : POPLD (HMM E-Value=2.5) Length = 181 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R V N D+F+++ GE + I Sbjct: 48 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGVRNNGLGDVFVFYPGEGYRNVRVI 104 Query: 449 PSYDTQSNVVPKN 487 YDT ++ P + Sbjct: 105 RGYDTAADEYPSH 117 >SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) Length = 492 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 251 LEWESTFSTSRQHESFRHVTELFRH 177 LEW +FS + + F H+TEL RH Sbjct: 369 LEWRLSFSNAEK-TLFAHMTELMRH 392 >SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) Length = 274 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 15 NWIKFFELDWFTTKLTAGQNKIIRNSNE 98 +W++ F+LDW + KL +N + + E Sbjct: 135 SWLRLFKLDWPSIKLVQSKNTALSDLTE 162 >SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) Length = 461 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = +2 Query: 269 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 448 PF KG P++ + + F L R N + D+F+++ GE + I Sbjct: 267 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHWLGDVFVFYPGEGYRNVHVI 323 Query: 449 PSYDTQSNVVPKN 487 YDT ++ P + Sbjct: 324 RGYDTAADEYPSH 336 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,223,081 Number of Sequences: 59808 Number of extensions: 405828 Number of successful extensions: 1320 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1316 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -