BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0533 (483 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical p... 30 0.77 Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical p... 30 0.77 U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical pr... 29 1.8 U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical pr... 29 1.8 Z81507-1|CAB04133.1| 485|Caenorhabditis elegans Hypothetical pr... 29 2.3 AF036698-2|AAB88353.1| 485|Caenorhabditis elegans Puf (pumilio/... 29 2.3 L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polym... 27 5.4 Z81532-7|CAJ34990.1| 363|Caenorhabditis elegans Hypothetical pr... 27 7.1 Z81532-6|CAB04326.3| 1128|Caenorhabditis elegans Hypothetical pr... 27 7.1 U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical pr... 27 7.1 >Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical protein ZK1320.12b protein. Length = 497 Score = 30.3 bits (65), Expect = 0.77 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 78 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 188 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical protein ZK1320.12a protein. Length = 495 Score = 30.3 bits (65), Expect = 0.77 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 78 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 188 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical protein T12A2.15b protein. Length = 222 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 365 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 463 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 120 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 152 >U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical protein T12A2.15a protein. Length = 713 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 365 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 463 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 611 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 643 >Z81507-1|CAB04133.1| 485|Caenorhabditis elegans Hypothetical protein F18A11.1 protein. Length = 485 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 135 VITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVESD 260 ++ V+++L N K+ C ++ QL IVR+C+ + S+ Sbjct: 257 LVQQVIDRLAENPKLPCFKFRIQLLHSLMTCIVRNCYRLSSN 298 >AF036698-2|AAB88353.1| 485|Caenorhabditis elegans Puf (pumilio/fbf) domain-containingprotein 7 protein. Length = 485 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 135 VITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVESD 260 ++ V+++L N K+ C ++ QL IVR+C+ + S+ Sbjct: 257 LVQQVIDRLAENPKLPCFKFRIQLLHSLMTCIVRNCYRLSSN 298 >L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polymerase kappa) homologprotein 1 protein. Length = 518 Score = 27.5 bits (58), Expect = 5.4 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 75 ADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNN--KMNCMEYAYQLWLQGSKDIVRDCFP 248 A Y S +K + EEK E I N + R K + ++ L+ S+D+ RDC Sbjct: 29 ASYSSFSKKQQSRIEEKVLE-IKNRLQTATREERQKSEILMENLEMKLESSRDLSRDCVC 87 Query: 249 VESD 260 ++ D Sbjct: 88 IDMD 91 >Z81532-7|CAJ34990.1| 363|Caenorhabditis elegans Hypothetical protein F36F2.3b protein. Length = 363 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 52 SFTIASSSPITTVRLKRASIYTRRRRAKSSQMS 150 SFT+ASS P T +R+++ S + + + + S Sbjct: 285 SFTVASSKPTTNIRVRQYSSSSSTKEQEDEERS 317 >Z81532-6|CAB04326.3| 1128|Caenorhabditis elegans Hypothetical protein F36F2.3a protein. Length = 1128 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 52 SFTIASSSPITTVRLKRASIYTRRRRAKSSQMS 150 SFT+ASS P T +R+++ S + + + + S Sbjct: 1050 SFTVASSKPTTNIRVRQYSSSSSTKEQEDEERS 1082 >U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical protein C03F11.3 protein. Length = 563 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 178 ILLFRISLFTTFVMTSLFFSSYK 110 I LF +S FTT + L FS YK Sbjct: 206 ISLFNVSPFTTVTVDQLLFSGYK 228 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,402,279 Number of Sequences: 27780 Number of extensions: 164571 Number of successful extensions: 619 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 892829112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -