BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0517 (453 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal pro... 27 6.4 L23645-9|AAK26134.1| 1226|Caenorhabditis elegans Hypothetical pr... 27 8.4 >AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal protein, large subunitprotein 19 protein. Length = 198 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 241 CNYNSIWLFIGKIIRLSTSNSRNSLFFISLDGIIYESNSILLRSEYSYLQY 393 C + +WL ++ +S +NSR S+ + DG+I + + S + +Y Sbjct: 17 CGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIR-KPVTVHSRFRAREY 66 >L23645-9|AAK26134.1| 1226|Caenorhabditis elegans Hypothetical protein F54F2.1 protein. Length = 1226 Score = 26.6 bits (56), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 186 ANPGRLNQTNFFINRPGIFFGQ 121 A PG+ NQ FI PG+++ Q Sbjct: 197 AVPGKKNQNRVFIGAPGVWYWQ 218 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,317,214 Number of Sequences: 27780 Number of extensions: 158515 Number of successful extensions: 272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 799252350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -