BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0501 (417 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC191.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 4.7 SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 ... 25 6.2 SPAC1783.04c |hst4||Sir2 family histone deacetylase Hst4|Schizos... 25 6.2 >SPCC191.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 138 Score = 25.0 bits (52), Expect = 4.7 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = +2 Query: 275 IMSTSIISINCFLFHHYFRWIFFWAFLGISFYRHW 379 I+S S+ + L H YF F + S + W Sbjct: 6 ILSCSVYDFSSILLHQYFTQFFVLRYASPSMHLDW 40 >SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 24.6 bits (51), Expect = 6.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 27 WEAHQRSRKGRSWRRTTFWCFVNWCIISALTL 122 W H++ K WR +FW F +C I+A L Sbjct: 392 WINHEK--KIDLWRPFSFWLFSIFCTIAAYYL 421 >SPAC1783.04c |hst4||Sir2 family histone deacetylase Hst4|Schizosaccharomyces pombe|chr 1|||Manual Length = 415 Score = 24.6 bits (51), Expect = 6.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -1 Query: 120 RSGQKLYTS*QNTRTSYAANCDPSANVDGLPIKDLKIAN 4 RS + L++S R Y NC DG +DLK N Sbjct: 78 RSSEGLFSS---LRAEYKLNCSGKELFDGSVYRDLKSVN 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,366,394 Number of Sequences: 5004 Number of extensions: 21511 Number of successful extensions: 47 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -