BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0494 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.07c |||TATA binding protein interacting protein |Schizo... 28 0.78 >SPAC1565.07c |||TATA binding protein interacting protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1220 Score = 28.3 bits (60), Expect = 0.78 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 146 NKNRISTISFLISKYCRRSFMNK*FYINNMTKNFTYILLSY 268 +KN +S +S L+S + F+NK FY + + +F IL Y Sbjct: 98 SKNYLSALSLLLSNSNVQPFVNK-FYTSTVFPSFLQILKQY 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 985,390 Number of Sequences: 5004 Number of extensions: 10278 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -