SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0481
         (626 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    23   1.6  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    23   2.8  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    23   2.8  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    22   4.8  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   4.8  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   4.8  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   4.8  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   4.8  

>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 458 KELGINLRGWNW 423
           ++LGINL  W+W
Sbjct: 199 EDLGINLHHWHW 210



 Score = 21.0 bits (42), Expect = 8.4
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  AVQAVVCKNDIKKTFYFGISGIPSQFSFE 148
           A + VV KN   + FY+    I ++++FE
Sbjct: 218 AAREVVAKNRRGELFYYMHQQIIARYNFE 246


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 334 AAWLEENLLVQYRVATTE-RFIIYLPSGTFIQFQPLKLIPSSLC 462
           AAW     + +++   T  +   Y  +GT I F  L LI  SLC
Sbjct: 139 AAWTNGTEVAKFKNMWTRFQLKYYQVTGTPIIFHNLTLITYSLC 182


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 334 AAWLEENLLVQYRVATTE-RFIIYLPSGTFIQFQPLKLIPSSLC 462
           AAW     + +++   T  +   Y  +GT I F  L LI  SLC
Sbjct: 139 AAWTNGTEVAKFKNMWTRFQLKYYQVTGTPIIFHNLTLITYSLC 182


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = -1

Query: 458 KELGINLRGWNW 423
           +++G+NL  W+W
Sbjct: 199 EDIGLNLHHWHW 210


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 265 THEIEQLEIEPV 300
           TH+I+ LEI+PV
Sbjct: 338 THQIQVLEIKPV 349


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 265 THEIEQLEIEPV 300
           TH+I+ LEI+PV
Sbjct: 338 THQIQVLEIKPV 349


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 265 THEIEQLEIEPV 300
           TH+I+ LEI+PV
Sbjct: 338 THQIQVLEIKPV 349


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 265 THEIEQLEIEPV 300
           TH+I+ LEI+PV
Sbjct: 338 THQIQVLEIKPV 349


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,328
Number of Sequences: 336
Number of extensions: 2945
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16083914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -