BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0481 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1554 + 27841801-27842007,27842282-27842455,27842554-278426... 36 0.026 10_01_0039 + 447573-448911,451247-451296,451322-451423 28 7.0 >08_02_1554 + 27841801-27842007,27842282-27842455,27842554-27842653, 27843273-27843725,27843936-27844469,27844500-27844580, 27844690-27844781,27844890-27844963,27845071-27845293, 27845429-27845522,27845607-27845761,27845899-27846129, 27846803-27847003,27847257-27847382,27847497-27847558, 27847775-27847892,27848040-27848324,27848475-27848513 Length = 1082 Score = 35.9 bits (79), Expect = 0.026 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 289 IEPVTSNDWEIAERNAAWLEENLLVQYRVA-TTERFIIYLPSGTFIQFQPLKLIPSSLCG 465 IEP + +DWEI E A EE +L Q V +F ++L ++F P Sbjct: 102 IEPFSEDDWEILESRADLAEETILTQVGVVYEGMKFPLWLDGHNIVKFVVTSSSPKKSLV 161 Query: 466 RLLRTTEV 489 +L+ TEV Sbjct: 162 QLVPGTEV 169 >10_01_0039 + 447573-448911,451247-451296,451322-451423 Length = 496 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 473 NRRPHKELGINLRGWNWINVPEG 405 +RR H L +++ G W+++PEG Sbjct: 292 HRRVHAYLPLSMHGRRWLHIPEG 314 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,436,216 Number of Sequences: 37544 Number of extensions: 270918 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -