BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0468 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC521.04c |||calcium permease |Schizosaccharomyces pombe|chr 1... 27 2.1 SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schiz... 27 3.6 >SPAC521.04c |||calcium permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 881 Score = 27.5 bits (58), Expect = 2.1 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 473 NLRVQCHGS*NIRNASQLIFIHLCLHVRVITIELQSTIC*LYLFFRP 613 N + C+ + + RNAS +I+ + + T+ + S IC +FF P Sbjct: 304 NQSLDCNTTPHRRNASSIIYTLMYYLIIAPTLLITSAICMFTIFFVP 350 >SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +1 Query: 442 KKNYNLENLHEPSCAMSRVMKHSKCVTIDFYSSLFTRTGNYY*IAINDMLIIFIFSSADR 621 + ++N+E L S +S + ++C + D + +F+R Y A + + DR Sbjct: 353 RPSFNMEELELLSEVLSTFLSFNECASQDKKNCVFSRVTKYIKAARRASTANRVSVAKDR 412 Query: 622 *ALTP 636 +LTP Sbjct: 413 LSLTP 417 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,652,666 Number of Sequences: 5004 Number of extensions: 47562 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -